[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55955.1
DDBJ      :             solute-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  190/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:372 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   115->283 1gcaA PDBj 1e-07 26.8 %
:RPS:PDB   42->288 1apbA PDBj 7e-22 13.8 %
:RPS:SCOP  42->343 1gcaA  c.93.1.1 * 2e-22 20.8 %
:HMM:SCOP  41->343 2fvyA1 c.93.1.1 * 7.1e-69 30.7 %
:HMM:PFM   83->254 PF00532 * Peripla_BP_1 2.5e-07 22.9 157/279  
:BLT:SWISS 44->356 XYLF_HAEIN 2e-39 35.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55955.1 GT:GENE AAZ55955.1 GT:PRODUCT solute-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2247903..2249021) GB:FROM 2247903 GB:TO 2249021 GB:DIRECTION - GB:PRODUCT solute-binding protein GB:PROTEIN_ID AAZ55955.1 GB:DB_XREF GI:71916053 LENGTH 372 SQ:AASEQ MSNRNIVRRVAVGAAAVLLATVGCTTGTEGEQQAAASIDEGFTIGLLLPESKTARYEKFDRPYFEEAVAELCPKCEVSYQNADQDVSKQQAQAEAMLTEGASVLVLDAVDAKAAGSIVQQAKAQGVPVIAYDRLAEGGVDYYVSFDNKTVGRVQGTALIEGMEKAGTAGEGQVIMINGSPTDPNAADFKAGAHEILDGQVEIGAEYDTPDWSPDKAQQQMEQAITAVGADNISGVYSANDGMAAGIIAALKAAGVDEMPPITGQDAELAGIQRIISGDQYMTVYKAIRPEAEVAAAMAVAAATGEKYEGSQEHPLTEVTDEAGNTIPAVLLEPIAVTADNIEDTVISDGFYTIEEICTDQYADTELCKGAGS GT:EXON 1|1-372:0| BL:SWS:NREP 1 BL:SWS:REP 44->356|XYLF_HAEIN|2e-39|35.0|297/332| SEG 7->23|vrrvavgaaavllatvg| SEG 101->114|asvlvldavdakaa| SEG 243->254|aagiiaalkaag| SEG 290->302|eaevaaamavaaa| BL:PDB:NREP 1 BL:PDB:REP 115->283|1gcaA|1e-07|26.8|168/309| RP:PDB:NREP 1 RP:PDB:REP 42->288|1apbA|7e-22|13.8|239/305| HM:PFM:NREP 1 HM:PFM:REP 83->254|PF00532|2.5e-07|22.9|157/279|Peripla_BP_1| RP:SCP:NREP 1 RP:SCP:REP 42->343|1gcaA|2e-22|20.8|284/309|c.93.1.1| HM:SCP:REP 41->343|2fvyA1|7.1e-69|30.7|290/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 278 OP:NHOMOORG 190 OP:PATTERN -------------------------------------------------------------------- -1-14--------------------3------1-----111--1311-3221211--111112-3113321-----11------------------------------------------------------------------3---------------------------------------1------11----------------1122------21-----------3------------------------------------------------------------------------------------------23--2----------3-------2---------------1--12-12---------------1-111--------22332232333--------122--322332234333-----1-22122-11--------111---------------------------------------------1111112----1111-----1-11------2212-1------22---------------------------------------------------1---------------------------------------1--------------------------------1111-1-1111111111-111111111111111111-11211-------------------111-111-1-1111111-1111-----------------21111----111-11-------------------11------1-1-------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 84.9 SQ:SECSTR #################################HHHTTcccEEEEEEEcccccHHHHcTTcHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHTTccEEEEEcccGGGHHHHHHHHHHTTcEEEEEccccccTTccEEEEcHHHHHHHHHHHHHHHHHHHTccGGGEEEEEEEcTTcHHHHHHHHHHHHHHTccGGGEEEEEcccccHHHHHHHHHHHHTTcTTccEEEEEcccHHHHHHHHHHHHHTTcGEEEEEEEcGGGHHHHTccccccEEEEEEccHHHHHHHHHHHHHHHHTTccccTTcEETTTEEcEEETTTTEEEccccEEEcTTTGGGHHHHHH####################### DISOP:02AL 1-5, 27-39| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccccccEEEEEcHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHccccccccEEcccEEEEccccccccEEEEccEEEcHHHHHHHccccccEEHHHHHccccccccccHHccc //