[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55959.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  250/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->302 1nqkA PDBj 7e-11 30.9 %
:RPS:PDB   4->312 3b4yA PDBj 3e-44 23.0 %
:RPS:SCOP  4->312 1brlB  c.1.16.1 * 8e-46 18.6 %
:HMM:SCOP  2->313 1ezwA_ c.1.16.3 * 4.9e-72 35.6 %
:RPS:PFM   16->284 PF00296 * Bac_luciferase 6e-22 36.8 %
:HMM:PFM   5->286 PF00296 * Bac_luciferase 1.8e-67 35.8 268/307  
:BLT:SWISS 20->198 Y978_MYCBO 1e-15 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55959.1 GT:GENE AAZ55959.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2254880..2255821) GB:FROM 2254880 GB:TO 2255821 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55959.1 GB:DB_XREF GI:71916057 LENGTH 313 SQ:AASEQ MRGMRLRIFTEPQQGASYETLLTVAKASEDLGFDGFFRSDHYLKMGDVSGLPGPTDAWVTLAGLARETSRIRLGTLMTAATFRLPGPLAISVAQVDQMSGGRVEFGLGAGWFEAEHTAYGIPFPADAKERFDRFEEQLAIITGLWATPEGETFTFHGKHYTLTESPALPKPAQSPRPPVLIGGRGRRRTPQLAAKYADEYNIPFCVVEETQAAFDRVRAEVEKAGREIPMIYSAAQVVCVGRNDAEVARRAAAIGREVDELKVNGLAGTPDEVVEKIGRFAEIGAERIYLQVLDLSDLDHLELIADRVAPQVA GT:EXON 1|1-313:0| BL:SWS:NREP 1 BL:SWS:REP 20->198|Y978_MYCBO|1e-15|36.5|170/282| BL:PDB:NREP 1 BL:PDB:REP 56->302|1nqkA|7e-11|30.9|233/345| RP:PDB:NREP 1 RP:PDB:REP 4->312|3b4yA|3e-44|23.0|296/323| RP:PFM:NREP 1 RP:PFM:REP 16->284|PF00296|6e-22|36.8|253/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 5->286|PF00296|1.8e-67|35.8|268/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 4->312|1brlB|8e-46|18.6|296/319|c.1.16.1| HM:SCP:REP 2->313|1ezwA_|4.9e-72|35.6|295/0|c.1.16.3|1/1|Bacterial luciferase-like| OP:NHOMO 874 OP:NHOMOORG 286 OP:PATTERN --------1111111--------22--1--2----11-11111---1-11----------------11 1---K--111----EKG77-7G--IR77777GHIKIDCGF2H4J68--3---2221----445-7673354-----------6-------------------------1---------------------------22222----5------2-------------1--3-------------1-------1-111111121-111111--11-11113-1-11--------1--------------------------------------------------------------------------------------------------------------------------------------------1--222------2126711-1--2-------------22122121363-A664322112111111--11------1---------11-2-----------------------------------8-------4444451----33221111-1521112---33-1-2---3-12-----1-2--------------------------------------------1--------------1-----------------1-----------------------------------------22-211111111111-111111111111111111-22311-------------------2--1111----111111-1111-----------------1---------------3332326---5133232235-3332-233----------------------------------1111----------------------------------------------------------- ---------------121-1--1-----------------------11---------1-111------------------------------2------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 99.4 SQ:SECSTR ##TcEEEEEEcTTTccHHHHHHHHHHHHHHTTTcEEEEcccccccccTTccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHcTTcEEEEEccccHHHHTTTTcccccccHHHHHHHHHHHHHHHHHHTHHTHTccEEEEccccEEEEEccccccTcTTcccEEEEccccHHHHHHHHHHccEEEEccccHHHHHHTHHHHHHHHHHTTcccTTcEEEEEEEEEcccHHHHHTTGGGGGGGccHHHHHHEEccHHHHHHHHHHHHHTTccEEEEEcccccHHHHHHHHHHHTHHHHc DISOP:02AL 313-314| PSIPRED ccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEHHcccccccccccccccHHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEcccccccccEEEEccccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHcc //