[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55977.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:398 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->113 1dziA PDBj 4e-04 17.6 %
:RPS:PDB   139->368 3cl6A PDBj 5e-12 14.7 %
:RPS:SCOP  49->368 1z7aA1  c.6.2.6 * 1e-14 15.1 %
:HMM:SCOP  61->370 1z7aA1 c.6.2.6 * 6.5e-22 22.9 %
:HMM:PFM   3->22 PF10518 * TAT_signal 9.9e-05 35.0 20/26  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55977.1 GT:GENE AAZ55977.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2273001..2274197 GB:FROM 2273001 GB:TO 2274197 GB:DIRECTION + GB:PRODUCT putative secreted protein GB:PROTEIN_ID AAZ55977.1 GB:DB_XREF GI:71916075 LENGTH 398 SQ:AASEQ MGKISRRTFLSATALTALGTVGCSTTQAGTGPEAAPRRVRVIGDGSTSDTGPQPNQPTVDQLDRRSGPPQFVVVSWDGAGELSDRLFSRFREVARRNNAHMTFFLSGIYLLPEHRKHLYHPPKHPVGASDIGYLSEESIHRTIRQLDLAWREGHEIGTHFNGHFCGPNGVSTWSPADWESEIQQAIKFVMTWKTNTGFTDLPPLPFDYRKELVGGRTPCLQGRDQLLPTAAKLGWRYDASSPGWLQVWPVRRHGLWDFPLQSLPMAGEDFEVLSMDYNIMVNQSKTPQGDRSKYGRWRAQARDTYLKGFERAYFSNRAPLFIGNHFQRWNGGIYMDAVEQFMDEIGGEPDVRMVSFRQLADWLDAQDPGVLTKLARLNVGQAPPGGWEEYLNSDAPLP GT:EXON 1|1-398:0| RP:PDB:NREP 2 RP:PDB:REP 26->113|1dziA|4e-04|17.6|85/185| RP:PDB:REP 139->368|3cl6A|5e-12|14.7|197/302| HM:PFM:NREP 1 HM:PFM:REP 3->22|PF10518|9.9e-05|35.0|20/26|TAT_signal| RP:SCP:NREP 1 RP:SCP:REP 49->368|1z7aA1|1e-14|15.1|258/301|c.6.2.6| HM:SCP:REP 61->370|1z7aA1|6.5e-22|22.9|245/0|c.6.2.6|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 38 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------1--------1-------1--3221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-111---------11--111111111111-----------------------------------------------------------------------------------------------------------------------------------------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 83.7 SQ:SECSTR #########################cGGGTcccccEEEEEEEEccccccG###GGHHHHHHHHHHccccEEEEEEEEcccHHccTTHHHHHHHHHHTTcccEEEEcHHHHHHH##HHHHHHHHHHTTcccEEEEcGGGHHHcHHHHHHHHHTTcEEEEccccccccTT####ccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEccccccTTHHHHHHHHccccEEcccccccccEEccccTTccccHHG#GGTTccEEcHEEccccccccGGGGGcccccccHHHHHHHHHHHHHHHHHHTTTccEEEEEEEEHHHHTcHHHHHHHHHHHHHHHTcccEEEccHHHHHHHHHHHcc############################## DISOP:02AL 1-3, 19-38, 52-64, 396-398| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccccccccccEEccccccccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHcccccEEEEEEEEEEcccHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccHHHHHHHHHcccEEEEEcccccccccccccccccccHHHcccccccccccEEHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHccccHHHHHccccccccccHHHHHHHcccccccc //