[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55982.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   82->156 PF03703 * DUF304 2e-12 40.5 %
:HMM:PFM   82->159 PF03703 * DUF304 2e-21 34.6 78/80  
:BLT:SWISS 9->164 YDBS_BACSU 2e-07 24.3 %
:TM
:REPEAT 2|98->118|120->139

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55982.1 GT:GENE AAZ55982.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2279792..2280310) GB:FROM 2279792 GB:TO 2280310 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ55982.1 GB:DB_XREF GI:71916080 LENGTH 172 SQ:AASEQ MTTVQLRPPKNRVSPRAVWLWTVTDAIEGAVTVGGITLTAWAVDTARWGWLPDWLVDRIWWVPVAVACYSVVKLVVAPRWRYRVYRWEVTADVVYTRKGWISRTWQLVPITRLQTVDHTQGWLERLFDLATVEIQTASHAGSSTIKGLPEAQARQLSEELAARAGQLRSDAT GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 9->164|YDBS_BACSU|2e-07|24.3|148/100| TM:NTM 2 TM:REGION 25->47| TM:REGION 58->79| NREPEAT 1 REPEAT 2|98->118|120->139| RP:PFM:NREP 1 RP:PFM:REP 82->156|PF03703|2e-12|40.5|74/78|DUF304| HM:PFM:NREP 1 HM:PFM:REP 82->159|PF03703|2e-21|34.6|78/80|DUF304| OP:NHOMO 35 OP:NHOMOORG 33 OP:PATTERN ----------------------------1--------------------------------------- ------1-11----1--11-11---11-111-11111111-----1-1--------1-----1-111--11--------------------------------------------------------------------------------------------------------------------------1---------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 165-172| PSIPRED ccEEEccccHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEEEEEEEEEEcHHHHHcccEEEEEEEccccccEEEEcccHHHHHHHHHHHHHHHHHcccccc //