[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55999.1
DDBJ      :             Protein of unknown function UPF0047
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  107/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->133 2p6hA PDBj 5e-13 41.1 %
:RPS:PDB   6->133 2cu5B PDBj 4e-25 30.6 %
:RPS:SCOP  1->133 1vphA  d.273.1.1 * 3e-33 27.3 %
:HMM:SCOP  1->132 1vphA_ d.273.1.1 * 2.4e-29 36.6 %
:RPS:PFM   18->118 PF01894 * UPF0047 6e-13 39.6 %
:HMM:PFM   18->132 PF01894 * UPF0047 1.7e-28 36.0 114/118  
:BLT:SWISS 16->133 Y2586_MYCBO 2e-35 57.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55999.1 GT:GENE AAZ55999.1 GT:PRODUCT Protein of unknown function UPF0047 GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2298252..2298680) GB:FROM 2298252 GB:TO 2298680 GB:DIRECTION - GB:PRODUCT Protein of unknown function UPF0047 GB:PROTEIN_ID AAZ55999.1 GB:DB_XREF GI:71916097 InterPro:IPR001602 LENGTH 142 SQ:AASEQ MRTTVLELHTGTTESVTDITPQCATFVAETGGDGLLNVFVPHSTAGVAVMELGSRSDEDLLASLRDLLPPDDRWRHKHGTLGHGRSHVMPALIAPYATIPVVSGKLALGTWQSIAIVDLNVDNPDRQVRLSFLTSPSDGAGW GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 16->133|Y2586_MYCBO|2e-35|57.3|117/129| BL:PDB:NREP 1 BL:PDB:REP 41->133|2p6hA|5e-13|41.1|90/134| RP:PDB:NREP 1 RP:PDB:REP 6->133|2cu5B|4e-25|30.6|121/127| RP:PFM:NREP 1 RP:PFM:REP 18->118|PF01894|6e-13|39.6|101/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 18->132|PF01894|1.7e-28|36.0|114/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 1->133|1vphA|3e-33|27.3|132/138|d.273.1.1| HM:SCP:REP 1->132|1vphA_|2.4e-29|36.6|131/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 184 OP:NHOMOORG 162 OP:PATTERN 11-11111111111111111-111---111----111------11-122-21212221---------- ---1-----------1111-11--1111111111111-111111---1------------111-1111111----------1-111----------------------1-----------------1-112111---------1-1-111-----------------1111--------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------------1--1-11---111-11--------1--------1----22222------------1--11-1-----1-----------------------1------------------------------------------------------------------------1---------------------------1------------------------111--1--1--11----1-----1111---1----------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------1111-11-1--- ---------------------------11-1----------11---11----------------1----------------------1--------------------2--------------------------------------------------------------------116---1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 93.0 SQ:SECSTR ##cEEEEEEcccccEEEEcHHHHHHHHTTccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHcccccTTccGcTTcccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEccccccEEEEEEEEcE######## DISOP:02AL 138-142| PSIPRED ccEEEEEEEEccccEEEEccHHHHHHHHHccccEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEEcccccccEEEEEEEccccccccc //