[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56014.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  377/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->112 1uwdA PDBj 8e-14 33.7 %
:RPS:PDB   19->113 3cq1A PDBj 8e-24 35.1 %
:RPS:SCOP  19->115 1uwdA  d.52.8.2 * 4e-22 32.0 %
:HMM:SCOP  17->115 1uwdA_ d.52.8.2 * 6.4e-27 41.4 %
:RPS:PFM   24->75 PF01883 * DUF59 5e-09 61.5 %
:HMM:PFM   23->92 PF01883 * DUF59 5.4e-24 44.3 70/76  
:BLT:SWISS 18->106 YITW_BACSU 4e-19 47.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56014.1 GT:GENE AAZ56014.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2315477..2315839) GB:FROM 2315477 GB:TO 2315839 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56014.1 GB:DB_XREF GI:71916112 InterPro:IPR002744 LENGTH 120 SQ:AASEQ MSTGNEETTSTQTQTAEVDEALVEEITDALKDVIDPELGVNVVDLGLVYGVNVDERSIVIDMTLTSAACPLTDVLEEQVASTLDEFDRDVKINWVWMPPWGPDKITEDGRDQLRMLGFNV GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 18->106|YITW_BACSU|4e-19|47.2|89/102| SEG 2->15|stgneettstqtqt| BL:PDB:NREP 1 BL:PDB:REP 24->112|1uwdA|8e-14|33.7|89/102| RP:PDB:NREP 1 RP:PDB:REP 19->113|3cq1A|8e-24|35.1|94/98| RP:PFM:NREP 1 RP:PFM:REP 24->75|PF01883|5e-09|61.5|52/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 23->92|PF01883|5.4e-24|44.3|70/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 19->115|1uwdA|4e-22|32.0|97/102|d.52.8.2| HM:SCP:REP 17->115|1uwdA_|6.4e-27|41.4|99/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 493 OP:NHOMOORG 415 OP:PATTERN 11--111-111111121111-11-1------------------11-1---12--11111111111-11 -11-111111111111111-1111111111111111111121111111111111111111111111111111111111----3-11-2111111--1---111111-211--------------------------11112---11--------------------1----------------21122---2-1------1------1-111111---13311--111111--1111111111111111111113--111213322221111-12-11111111111112222222222211111111111111221112221----------------------------3------------------1--1-11111111111-1222211111122222222222-11311212211--11---2---22221-1112111111111111111111111-1-----------------------------111211------------1111-----11111-----2-------1-----2--------2-------------1-1-------------------------11-1---1111----------------1--21-----11--1--1---------------------1111---------------------------------------------------------------------------------------------------11111-111-----------------1--------1-----------------111111111---------------111-1-------------111111------------------------------------1111111111121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 83.3 SQ:SECSTR ##################ccHHHHHHHHHHTTcccTTTcccTTTTTcEEEEEEETTTEEEEEcccccccccccHHHHHHHHHHHTcTcEEEEEEcccccccGGGcccGGGTTTHHHTc## DISOP:02AL 1-21| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEcccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEEEEccccHHHccHHHHHHHHHHcccc //