[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56027.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  187/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:300 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  63->157 1s7bA_ f.39.1.1 * 8.3e-07 30.5 %
:HMM:SCOP  196->299 1s7bA_ f.39.1.1 * 8.4e-10 29.7 %
:HMM:PFM   44->151 PF00892 * EamA 7.1e-08 23.4 107/126  
:HMM:PFM   173->293 PF00892 * EamA 3.6e-18 26.4 121/126  
:HMM:PFM   142->203 PF02515 * CoA_transf_3 0.0009 25.8 62/191  
:BLT:SWISS 36->261 RHTA_ECOLI 2e-30 43.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56027.1 GT:GENE AAZ56027.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2326990..2327892 GB:FROM 2326990 GB:TO 2327892 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ56027.1 GB:DB_XREF GI:71916125 LENGTH 300 SQ:AASEQ MNSDSPGQSAPGPFSRAAALVRAAGTAIPATWLVGVSILSVQFGAGVAKNLFAVLPPSTVVWLRLLASALVLLCFAPPPLRGHSRTDWLVAVGFGTSLAVMNYAIYESFARIPLGVAVTIEFLGPLAVAVAGSRRWRDLVWVVLAGTGVALLGWDDGGVTLAGVAFAALAGAAWACYILLSAATGRRFPGTSGLTVASVIGAVLVAPMGLAHSSPALLDPSVLLTGLAVGLLSSVIPYSLEMQALRRIPPGVFGILMSLEPAAAALVGLVLLGEFLTVAQWAAVACVVVASVGATRSARL GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 36->261|RHTA_ECOLI|2e-30|43.3|224/295| TM:NTM 9 TM:REGION 21->43| TM:REGION 54->76| TM:REGION 89->111| TM:REGION 121->143| TM:REGION 161->183| TM:REGION 189->211| TM:REGION 218->240| TM:REGION 248->270| TM:REGION 274->296| SEG 17->27|aaalvraagta| SEG 60->76|vvwlrllasalvllcfa| SEG 157->175|ggvtlagvafaalagaawa| SEG 262->273|aaaalvglvllg| SEG 278->294|vaqwaavacvvvasvga| HM:PFM:NREP 3 HM:PFM:REP 44->151|PF00892|7.1e-08|23.4|107/126|EamA| HM:PFM:REP 173->293|PF00892|3.6e-18|26.4|121/126|EamA| HM:PFM:REP 142->203|PF02515|0.0009|25.8|62/191|CoA_transf_3| HM:SCP:REP 63->157|1s7bA_|8.3e-07|30.5|95/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 196->299|1s7bA_|8.4e-10|29.7|101/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 214 OP:NHOMOORG 188 OP:PATTERN -------------------------------------------------------------------- ----11112221-1----------12-----1-----223------1-----11-11---11111131122----1------1------------------1-------1-------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---112------------------------------11-1111--1--1---11-111----------------1---------111-------------------------------------1-111-1-------------11--------11111--111-----11----------------------1---1---------------------------1------------------------------1-11----11------11-------------------------1111-111111111111-111111-11111111111111111111111-1111111111-1111-1111--111111111111--1-------------1----------------3333322-----1111-11111211--11------------------------111---------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25| PSIPRED cccccccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc //