[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56067.1
DDBJ      :             hemolysin A
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  508/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.66.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->254 3hp7A PDBj 2e-32 41.4 %
:RPS:PDB   4->66 2cqjA PDBj 2e-04 19.0 %
:RPS:PDB   63->167 3douA PDBj 1e-08 24.0 %
:RPS:SCOP  6->74 1jh3A  d.66.1.4 * 3e-05 15.2 %
:RPS:SCOP  63->159 1eizA  c.66.1.2 * 8e-09 22.0 %
:HMM:SCOP  6->104 1c06A_ d.66.1.2 * 5.9e-25 36.4 %
:HMM:SCOP  63->250 1ej0A_ c.66.1.2 * 7.1e-25 26.0 %
:RPS:PFM   64->169 PF01728 * FtsJ 1e-10 50.5 %
:HMM:PFM   63->243 PF01728 * FtsJ 3.1e-25 29.5 156/181  
:HMM:PFM   6->50 PF01479 * S4 9.6e-13 40.0 45/48  
:BLT:SWISS 2->245 YQXC_BACSU 2e-39 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56067.1 GT:GENE AAZ56067.1 GT:PRODUCT hemolysin A GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2379176..2379976) GB:FROM 2379176 GB:TO 2379976 GB:DIRECTION - GB:PRODUCT hemolysin A GB:PROTEIN_ID AAZ56067.1 GB:DB_XREF GI:71916165 InterPro:IPR002942 InterPro:IPR004538 LENGTH 266 SQ:AASEQ MARRSRLDAELVRRGHARSRAHAAELIAAGRVRVAGTLATKAATQVGVDQAIVVEQADDEPVYVSRGAYKLIGALDAFAVDVTGRRCLDAGASTGGFTDVLLRRGAAHVVAVDVGYGQLAWSLRSDPRVTVLERQNVRELTPDQVGEPRPDLVVADLSFISLRLVLAPLLACAASDADFVLLVKPQFEVGRERVGAKGVVRDPEARASAVRDVAAHAWTLGLGVCGVTASPLPGPSGNVEYFLWLRSGAAPLDERQLERAVAEGPQ GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 2->245|YQXC_BACSU|2e-39|39.4|241/281| SEG 13->24|rrgharsrahaa| BL:PDB:NREP 1 BL:PDB:REP 48->254|3hp7A|2e-32|41.4|203/270| RP:PDB:NREP 2 RP:PDB:REP 4->66|2cqjA|2e-04|19.0|63/71| RP:PDB:REP 63->167|3douA|1e-08|24.0|104/170| RP:PFM:NREP 1 RP:PFM:REP 64->169|PF01728|1e-10|50.5|101/179|FtsJ| HM:PFM:NREP 2 HM:PFM:REP 63->243|PF01728|3.1e-25|29.5|156/181|FtsJ| HM:PFM:REP 6->50|PF01479|9.6e-13|40.0|45/48|S4| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 2 RP:SCP:REP 6->74|1jh3A|3e-05|15.2|66/99|d.66.1.4| RP:SCP:REP 63->159|1eizA|8e-09|22.0|91/181|c.66.1.2| HM:SCP:REP 6->104|1c06A_|5.9e-25|36.4|99/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 63->250|1ej0A_|7.1e-25|26.0|169/0|c.66.1.2|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 532 OP:NHOMOORG 523 OP:PATTERN ------------------------------------------------1------------------- 1111111111111111111-11111111111111111111111111111111111111--1111111111111111111112111111------------------------------------------------11111---111111111111111111111111111111111111111---111111111111111111111111111111111111111111111111-------------------111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11-1-111111111111111111111111111111111-11111111111-11111111111111111----------1111111111111111------------1111111111111-----11111--------------------------------------11111111111-------11-----------11111111111111111111111111111111111111111111111111111111111-------1---------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------1111111111111111--1----1--111---111111-1-11111-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11171111111-1-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 98.5 SQ:SECSTR #ccEEEHHHHHHHTTccccHHHHHHHHHTTcEEETTcccccTTcEEEHHHHTTEEEccccccTTcHHHHHHHHHHHHHccccTTcEEEEEccTTcHHHHHHTTTTccEEEEEEccccccTTcEEEEccTTcccHHHHHHHHHHHHTcccEEEEEEccccccccHHHHHHHHHEEEEEEEEEEEGGGHHHHHHHHHHTTcEEEEEEEcEEHHHHHHHHHHTTEEEEEEEEEEccGGGTTTTTHHHHHHHHHHHHHHTTTcHHHH### DISOP:02AL 1-2, 258-259, 262-266| PSIPRED cccHHHHHHHHHHcccHHHHHHHHHHHHccEEEEccEEEEccccccccccEEEEEccccccccEEEHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccEEEEEEcccccccHHHHccccEEEEEcccHHHccHHHccccccEEEEEEcHHHHHHHHHHHHHHHHccccEEEEEEcccEEEcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEccccccHHHHHHHHHcccc //