[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56072.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->113 1eygD PDBj 6e-05 26.2 %
:RPS:PDB   29->108 2cczA PDBj 1e-11 15.0 %
:RPS:SCOP  29->108 1ue1A  b.40.4.3 * 1e-11 20.3 %
:HMM:SCOP  27->139 1ue1A_ b.40.4.3 * 1.5e-12 24.8 %
:HMM:PFM   29->124 PF00436 * SSB 4.3e-13 28.4 95/104  
:BLT:SWISS 29->113 SSB_OCEIH 1e-09 34.1 %
:PROS 1->102|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56072.1 GT:GENE AAZ56072.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2383208..2383636) GB:FROM 2383208 GB:TO 2383636 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56072.1 GB:DB_XREF GI:71916170 InterPro:IPR010913 InterPro:IPR010916 LENGTH 142 SQ:AASEQ MDNPSALPSSSRRGTPAGWQTCEEVEHRNEILLAGRVIAEPSVRELHNGGQLVTWRIAVNRPSSKRRPRQEADPITCVSFHRDMVELTRDWRIGDTVQVTGALRRRFWRSVHGAASVFEVEAKTARRVKAADSSAVTSRGCQ GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 29->113|SSB_OCEIH|1e-09|34.1|85/161| PROS 1->102|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 29->113|1eygD|6e-05|26.2|84/112| RP:PDB:NREP 1 RP:PDB:REP 29->108|2cczA|1e-11|15.0|80/121| HM:PFM:NREP 1 HM:PFM:REP 29->124|PF00436|4.3e-13|28.4|95/104|SSB| RP:SCP:NREP 1 RP:SCP:REP 29->108|1ue1A|1e-11|20.3|79/113|b.40.4.3| HM:SCP:REP 27->139|1ue1A_|1.5e-12|24.8|113/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1-------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 86.6 SQ:SECSTR #################cTTccEEEETcccEEEEEEEEEEEEEEEETTTEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEccTTHHHHHTccTTcEEEEEEcEEcccccEEEEEEEEEEEEEEEEEEHHHHHHHHHHHHT## DISOP:02AL 1-20, 125-142| PSIPRED ccccccccccccccccccHHHHHHHHcccEEEEEEEEccccEEEEcccccEEEEEEEEEccccccccccccccEEEEEEEccHHHHHHHHHccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEcccccccccccccc //