[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56081.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->128 PF05331 * DUF742 4e-21 58.0 %
:HMM:PFM   16->128 PF05331 * DUF742 1.1e-39 55.4 112/114  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56081.1 GT:GENE AAZ56081.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2398584..2398970) GB:FROM 2398584 GB:TO 2398970 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56081.1 GB:DB_XREF GI:71916179 LENGTH 128 SQ:AASEQ MTDHHGTGRGPHWEEDAGPLVRPYAVTGGRTRPAESQLDMISTVVASRRETGITHLLPEHRAILRLCRSPVSVAEIAARVDLPITVVKVLLGDLVTQGFVLARAPMPPRAATSEMTLLQAVLDGIRRL GT:EXON 1|1-128:0| RP:PFM:NREP 1 RP:PFM:REP 15->128|PF05331|4e-21|58.0|112/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 16->128|PF05331|1.1e-39|55.4|112/114|DUF742| OP:NHOMO 98 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----5----------1111-11--1111111-11116-11-334----1-----------42--564AB96---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 109-110| PSIPRED cccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHcc //