[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56082.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.1d.110.7
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->126 1a0kA PDBj 2e-19 18.1 %
:RPS:SCOP  11->126 1a0kA  d.110.1.1 * 1e-19 18.1 %
:HMM:SCOP  1->129 1j3wA_ d.110.7.1 * 2.5e-34 43.8 %
:RPS:PFM   14->98 PF03259 * Robl_LC7 8e-11 44.0 %
:HMM:PFM   9->99 PF03259 * Robl_LC7 8.3e-27 33.3 90/91  
:BLT:SWISS 40->121 MNME_CHLCH 3e-04 25.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56082.1 GT:GENE AAZ56082.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2398967..2399389) GB:FROM 2398967 GB:TO 2399389 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56082.1 GB:DB_XREF GI:71916180 LENGTH 140 SQ:AASEQ MSNASENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLARGTSRQFKGGRVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVGQFLTSAPRHPEAAGRVSTGS GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 40->121|MNME_CHLCH|3e-04|25.3|79/100| RP:PDB:NREP 1 RP:PDB:REP 11->126|1a0kA|2e-19|18.1|116/130| RP:PFM:NREP 1 RP:PFM:REP 14->98|PF03259|8e-11|44.0|84/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 9->99|PF03259|8.3e-27|33.3|90/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 11->126|1a0kA|1e-19|18.1|116/130|d.110.1.1| HM:SCP:REP 1->129|1j3wA_|2.5e-34|43.8|128/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 121 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----9----------1111-11--1111111111116112-5462---1-----------64--575CBA6---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 82.9 SQ:SECSTR ##########HHHHHTccccTTcEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEEEEEEETTccHHHHHHHHHHHHHHHHHT############## DISOP:02AL 1-5, 127-140| PSIPRED cccccHHHHHHHHHHHHcccccEEEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccc //