[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56086.1
DDBJ      :             transcriptional regulator, ArgR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  424/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.74.2
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->166 3fhzD PDBj 3e-37 57.3 %
:RPS:PDB   8->59 2ahqA PDBj 3e-08 26.9 %
:RPS:PDB   106->172 1b4bA PDBj 8e-18 34.3 %
:RPS:SCOP  14->77 1b4aA1  a.4.5.3 * 1e-17 40.6 %
:RPS:SCOP  106->172 1b4bA  d.74.2.1 * 5e-18 34.3 %
:HMM:SCOP  7->83 1aoyA_ a.4.5.3 * 1.9e-22 50.6 %
:HMM:SCOP  103->173 1b4bA_ d.74.2.1 * 2.9e-18 52.1 %
:RPS:PFM   13->77 PF01316 * Arg_repressor 6e-12 52.3 %
:RPS:PFM   103->171 PF02863 * Arg_repressor_C 4e-12 43.5 %
:HMM:PFM   104->170 PF02863 * Arg_repressor_C 1.1e-27 47.8 67/70  
:HMM:PFM   12->78 PF01316 * Arg_repressor 7.2e-27 50.7 67/70  
:BLT:SWISS 10->173 ARGR_RENSM 2e-48 63.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56086.1 GT:GENE AAZ56086.1 GT:PRODUCT transcriptional regulator, ArgR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2404832..2405365) GB:FROM 2404832 GB:TO 2405365 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArgR family GB:PROTEIN_ID AAZ56086.1 GB:DB_XREF GI:71916184 InterPro:IPR001669 LENGTH 177 SQ:AASEQ MTVDGAKSAPPTKAARHAKITELLTKYAVRSQNELARLLAEEGVQVTQATLSRDLDELGAVKLRTVDGNLVYVLPGEGGERLPRAHADELELEQVSNPRLSRLAEDLLVSAEASANIVVVRTPPGAAQYLASAIDHSDIPAILGTIAGDDTILVVARDPQGGEELAATLLRFANRRV GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 10->173|ARGR_RENSM|2e-48|63.5|159/179| BL:PDB:NREP 1 BL:PDB:REP 13->166|3fhzD|3e-37|57.3|143/166| RP:PDB:NREP 2 RP:PDB:REP 8->59|2ahqA|3e-08|26.9|52/67| RP:PDB:REP 106->172|1b4bA|8e-18|34.3|67/71| RP:PFM:NREP 2 RP:PFM:REP 13->77|PF01316|6e-12|52.3|65/69|Arg_repressor| RP:PFM:REP 103->171|PF02863|4e-12|43.5|69/70|Arg_repressor_C| HM:PFM:NREP 2 HM:PFM:REP 104->170|PF02863|1.1e-27|47.8|67/70|Arg_repressor_C| HM:PFM:REP 12->78|PF01316|7.2e-27|50.7|67/70|Arg_repressor| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01316|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01316|IPR001669| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02863|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02863|IPR001669| RP:SCP:NREP 2 RP:SCP:REP 14->77|1b4aA1|1e-17|40.6|64/75|a.4.5.3| RP:SCP:REP 106->172|1b4bA|5e-18|34.3|67/72|d.74.2.1| HM:SCP:REP 7->83|1aoyA_|1.9e-22|50.6|77/0|a.4.5.3|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 103->173|1b4bA_|2.9e-18|52.1|71/71|d.74.2.1|1/1|C-terminal domain of arginine repressor| OP:NHOMO 527 OP:NHOMOORG 425 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111---111111--11121121111111111111111-----1111-1------------------------111111-11111-11111-----------------------------------------------1111111-111111111112112111112211111111111111111111111111111111111111114-2-22-2---22222221221-11133322323-133333333333222222222222232222222221111111111111111-111111111-1111111111111-1111111--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------2211--211111111111111111111111-------------21111211111111111-1111111111111111111111111111222222222222222111111111-111111111111----11111---------111111111111111-----------------------------1---------111-1111111211-----------------------------------------------------------------1-111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 93.2 SQ:SECSTR #######cccccHcHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTTcEEEEcccccEEEEcTTccEEEcccccccccHHcccHHHHHHHHHHHHEEEEEEETTEEEEEEcTTcHHHHHHHHHHHccTTEEEEEEcccEEEEEEccHHHHHHHHHHHHTT##### DISOP:02AL 1-16| PSIPRED ccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEcHHHHHHHHHHccEEEEEcccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHEEcccEEEEEEccccHHHHHHHHHHcccccEEEEEEcccEEEEEEccHHHHHHHHHHHHHHHHHcc //