[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56088.1
DDBJ      :             N-acetylglutamate kinase
Swiss-Prot:ARGB_THEFY   RecName: Full=Acetylglutamate kinase;         EC=2.7.2.8;AltName: Full=NAG kinase;         Short=AGK;AltName: Full=N-acetyl-L-glutamate 5-phosphotransferase;

Homologs  Archaea  45/68 : Bacteria  698/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
c.73.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->291 2bufF PDBj 1e-61 47.5 %
:RPS:PDB   9->294 2ap9B PDBj 5e-52 50.2 %
:RPS:SCOP  28->292 1gs5A  c.73.1.2 * 2e-73 25.7 %
:HMM:SCOP  3->297 2bufA1 c.73.1.2 * 2.8e-87 44.2 %
:RPS:PFM   31->264 PF00696 * AA_kinase 3e-12 32.6 %
:HMM:PFM   29->269 PF00696 * AA_kinase 4.3e-49 33.6 226/243  
:BLT:SWISS 1->302 ARGB_THEFY e-153 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56088.1 GT:GENE AAZ56088.1 GT:PRODUCT N-acetylglutamate kinase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2406570..2407478) GB:FROM 2406570 GB:TO 2407478 GB:DIRECTION - GB:PRODUCT N-acetylglutamate kinase GB:PROTEIN_ID AAZ56088.1 GB:DB_XREF GI:71916186 InterPro:IPR001057 InterPro:IPR004662 LENGTH 302 SQ:AASEQ MISRTRQEALDKAKTLIEALPWLSALHGKTVVVKYGGNAMTDPDLRARFAENIVFLRYAGLRPVVVHGGGPQINAHLERLGVESTFTAGLRVTTPETMEIVRMVLVGQVNREIVGLINEHGPFAVGMSGEDAHLFTAERKYAMVDGEPVDIGLVGEVVDVQPGAVRSLLDDGRIPIISSIARSAEGGVYNVNADTAAAALAVALGAAKLIVLTDVEGLYADYPVNSELISHMTASELEEMLPTLSSGMVPKMEACLRAVRGGVPQAHVLDGRIPNAMLLEIFTDEGVGTMVLPDKDPAGGDA GT:EXON 1|1-302:0| SW:ID ARGB_THEFY SW:DE RecName: Full=Acetylglutamate kinase; EC=2.7.2.8;AltName: Full=NAG kinase; Short=AGK;AltName: Full=N-acetyl-L-glutamate 5-phosphotransferase; SW:GN Name=argB; OrderedLocusNames=Tfu_2055; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Kinase; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->302|ARGB_THEFY|e-153|100.0|302/302| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| TM:NTM 1 TM:REGION 195->217| SEG 173->184|ripiissiarsa| SEG 193->209|adtaaaalavalgaakl| BL:PDB:NREP 1 BL:PDB:REP 5->291|2bufF|1e-61|47.5|284/291| RP:PDB:NREP 1 RP:PDB:REP 9->294|2ap9B|5e-52|50.2|279/285| RP:PFM:NREP 1 RP:PFM:REP 31->264|PF00696|3e-12|32.6|224/244|AA_kinase| HM:PFM:NREP 1 HM:PFM:REP 29->269|PF00696|4.3e-49|33.6|226/243|AA_kinase| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 1 RP:SCP:REP 28->292|1gs5A|2e-73|25.7|253/259|c.73.1.2| HM:SCP:REP 3->297|2bufA1|2.8e-87|44.2|292/0|c.73.1.2|1/1|Carbamate kinase-like| OP:NHOMO 1105 OP:NHOMOORG 858 OP:PATTERN ---1---11111111--1111--11--111-11111111111111111111111-------1--1-11 1111211111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111----11-1-1111111---------------11111111111211221112111111111111111111111111111111111111112221111-111111111111111111111111111111111111111111-11111111111111----1-------1---11-------11-111-------111------------------------1--111----11-11-------1-111111---1-1--111111111111-111111--1121111111111111111111111111111111111-11111111111-1111111111111111-1111111111111111111111111111111111--11-------------111111111121112223322222222222222222222222221222212222122212212222232222222222222-12111111111111111111111222212111-11111111--1-------1111122---1221-2--2222211122222211212---22221--11111221222222222122-222222222222222222222222211212222222222222212222221--222222221222---1---------222222222-22-------1222222222222222222222222222221--------211111111111111111111111111111111111111-------------------------------------11--11111221 ----11--------111-1111112-11111111111111111111111211111111111111111111111111111111111111-12111122111121121--1------------------------------------------------------------------21117111122254-111132121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 98.0 SQ:SECSTR #HcccHHcHHHHHHHHHTTHHHHHHHTTcEEEEEEcTHHcHcHHHHHHHHHHHHHHHTTTcEEEEEEcccHHHHHHHHHTTcccccccccccccHHHHHHHHHHHHHTHHHHHHHHHTTccccEEEEETTGGGcEEEEEccccccccccccccEEEEEEEcHHHHHHHHHTTcEEEEEcEEccTTcccEEEcHHHHHHHHHHHTTccEEEEEEcccccccccccTTccccEEETTTTGGGGTGGccTTHHHHHHHHHHHTTTccEEEEEETTcTTHHHHHHHccccccEEEEccTEE##### DISOP:02AL 1-5, 295-302| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHEEEccccEEEcccccccccccccccccHHHHHHHHHcccEEEEccccccccccEEEccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccEEEEEcccccccccc //