[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56098.1
DDBJ      :             LSU ribosomal protein L35P
Swiss-Prot:RL35_THEFY   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:63 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->54 3bbo5 PDBj 7e-11 51.9 %
:RPS:PDB   3->62 3bbo5 PDBj 8e-10 46.7 %
:RPS:SCOP  2->62 2hgj71  d.301.1.1 * 1e-10 34.4 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 4.1e-19 50.0 %
:RPS:PFM   2->62 PF01632 * Ribosomal_L35p 5e-05 49.2 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 3.6e-22 45.9 61/61  
:BLT:SWISS 1->63 RL35_THEFY 2e-32 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56098.1 GT:GENE AAZ56098.1 GT:PRODUCT LSU ribosomal protein L35P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2418767..2418958) GB:FROM 2418767 GB:TO 2418958 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L35P GB:PROTEIN_ID AAZ56098.1 GB:DB_XREF GI:71916196 InterPro:IPR001706 LENGTH 63 SQ:AASEQ MPKNKSHSGASRRFRVTGTGKIMRRRTNKNHLLEHKPSKRTRRLSVDVRVSPADARKIRKLLG GT:EXON 1|1-63:0| SW:ID RL35_THEFY SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=Tfu_2065; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->63|RL35_THEFY|2e-32|100.0|63/63| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| BL:PDB:NREP 1 BL:PDB:REP 3->54|3bbo5|7e-11|51.9|52/62| RP:PDB:NREP 1 RP:PDB:REP 3->62|3bbo5|8e-10|46.7|60/62| RP:PFM:NREP 1 RP:PFM:REP 2->62|PF01632|5e-05|49.2|61/61|Ribosomal_L35p| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|3.6e-22|45.9|61/61|Ribosomal_L35p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01632|IPR001706| GO:PFM GO:0005622|"GO:intracellular"|PF01632|IPR001706| GO:PFM GO:0005840|"GO:ribosome"|PF01632|IPR001706| GO:PFM GO:0006412|"GO:translation"|PF01632|IPR001706| RP:SCP:NREP 1 RP:SCP:REP 2->62|2hgj71|1e-10|34.4|61/63|d.301.1.1| HM:SCP:REP 2->65|2i2t31|4.1e-19|50.0|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 137 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-1111111111111111111111111111111111111111111111111111------11111-------------1------------1---------------11111-11111----------11-111-1111-----1-1-1------1-111-1-11---------1----------------1--------1-------------1------------------------------------------------------------------------------------------1-----------1-1----1111--1-1-----11---1---1---1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------1-------------------------------------------------------------1----------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------1---------------1-1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 98.4 SQ:SECSTR cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTT# DISOP:02AL 1-7, 33-43| PSIPRED ccccccccccccEEEEccccEEEEccccccHHHcccccHHHHcccccEEEcHHHHHHHHHHcc //