[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56117.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->76 PF05557 * MAD 9e-04 37.8 %
:BLT:SWISS 61->189 LPPN_MYCTU 2e-05 30.3 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56117.1 GT:GENE AAZ56117.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2445034..2445603) GB:FROM 2445034 GB:TO 2445603 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56117.1 GB:DB_XREF GI:71916215 LENGTH 189 SQ:AASEQ MTLGSPRWGIGRFVTVTATVAATLALSGCGLLLAQRDATVDEALRDLEQDLNEMEQDLEEPASPSATTEEDVFDIKVGDCLPAEETGVEGEISTVLTVPCSEPHSGEAYASGNMPDGSYPGDTEVQNFAEDFCSTEFDSFVGIPLEQSTLSYSYYFPTPESWAAGDREILCVVYDPAGDVTGSLQGAAR GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 61->189|LPPN_MYCTU|2e-05|30.3|119/175| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 33->60| SEG 14->26|vtvtatvaatlal| RP:PFM:NREP 1 RP:PFM:REP 40->76|PF05557|9e-04|37.8|37/668|MAD| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------11----1------1---1------1111---------2---1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 186-189| PSIPRED cccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEcEEEcccccccccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHccHHHHHHHHcccccccEEEEEccccccHHHcccccEEEEEEEcccccHHHccccccc //