[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56125.1
DDBJ      :             protein translocase subunit yajC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  187/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->100 PF02699 * YajC 4e-12 46.2 %
:HMM:PFM   20->99 PF02699 * YajC 8e-32 48.8 80/83  
:BLT:SWISS 20->101 Y893_RICCN 3e-14 37.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56125.1 GT:GENE AAZ56125.1 GT:PRODUCT protein translocase subunit yajC GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2455142..2455450) GB:FROM 2455142 GB:TO 2455450 GB:DIRECTION - GB:PRODUCT protein translocase subunit yajC GB:PROTEIN_ID AAZ56125.1 GB:DB_XREF GI:71916223 InterPro:IPR003849 LENGTH 102 SQ:AASEQ MQGLITLAEQQPQNQGAGLISQLLMFALIIVVFYLLFIRPQQKRRQQELEMQKSLQPGMEVLTGAGIYGTIVEVHDDDVELEISPGTRVRMVKAAVARIVSS GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 20->101|Y893_RICCN|3e-14|37.8|82/141| TM:NTM 1 TM:REGION 18->39| RP:PFM:NREP 1 RP:PFM:REP 23->100|PF02699|4e-12|46.2|78/82|YajC| HM:PFM:NREP 1 HM:PFM:REP 20->99|PF02699|8e-32|48.8|80/83|YajC| OP:NHOMO 187 OP:NHOMOORG 187 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------1-------111------1--111-------1------------1-11-1111-1------11----1-11---------------------------------------------------------------------------------------------------1-----------1---------11----------------------------------------------------------------------------------------------------------1----------1---1-----1-----11--------1111-----11111-1111111------------11-11-11-------1---------11-11-1----111------------------1-------1111---1-11111------1---1-----11111111111111-111111111----11--1--1--1----1111---1-1-------11------1------11--1-1111-1111----1------1---------------------------1-------1111------1-1--1----1111---------------------------------------------------------------------------------------------1------------1----------------1111111-----1111111-111111111111111111---------------1111111111------------11-----------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 7-16, 40-55| PSIPRED cccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEccEEEEEEEEcccEEEEEEcccEEEEEEHHHHHHHHcc //