[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56130.1
DDBJ      :             putative glutamine amidotransferase
Swiss-Prot:PDXT_THEFY   RecName: Full=Glutamine amidotransferase subunit pdxT;         EC=2.6.-.-;AltName: Full=Glutamine amidotransferase glutaminase subunit pdxT;

Homologs  Archaea  65/68 : Bacteria  223/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->200 2nv0A PDBj 2e-48 54.9 %
:RPS:PDB   6->201 2abwA PDBj 1e-23 30.6 %
:RPS:SCOP  7->200 1q7rA  c.23.16.1 * 7e-31 49.5 %
:HMM:SCOP  7->200 2abwA1 c.23.16.1 * 6.7e-50 43.9 %
:RPS:PFM   10->200 PF01174 * SNO 3e-57 62.8 %
:HMM:PFM   10->199 PF01174 * SNO 4.3e-61 44.0 182/188  
:BLT:SWISS 1->201 PDXT_THEFY e-113 100.0 %
:PROS 45->55|PS01236|PDXT_SNO_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56130.1 GT:GENE AAZ56130.1 GT:PRODUCT putative glutamine amidotransferase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2458714..2459319) GB:FROM 2458714 GB:TO 2459319 GB:DIRECTION - GB:PRODUCT putative glutamine amidotransferase GB:PROTEIN_ID AAZ56130.1 GB:DB_XREF GI:71916228 InterPro:IPR002161 LENGTH 201 SQ:AASEQ MSSVPPTIGVLALQGDVREHIHALEQAGARARRIRRPDELDSIDGLILPGGESTTMGRLAAVFGLLTPLRERIAAGLPAYGTCAGMIMLADRLADGAPGQQTIGGIDMTVRRNAFGRQVASFEGTVEMTGVDGGPVEAVFIRAPWVESTGPGVQVLGRISRGDTAGRIVAVRQGRLLATSFHPELTGDTRVHRLFVDMVKG GT:EXON 1|1-201:0| SW:ID PDXT_THEFY SW:DE RecName: Full=Glutamine amidotransferase subunit pdxT; EC=2.6.-.-;AltName: Full=Glutamine amidotransferase glutaminase subunit pdxT; SW:GN Name=pdxT; OrderedLocusNames=Tfu_2097; SW:KW Complete proteome; Glutamine amidotransferase; Pyridoxal phosphate;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->201|PDXT_THEFY|e-113|100.0|201/201| GO:SWS:NREP 2 GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 45->55|PS01236|PDXT_SNO_1|PDOC00950| BL:PDB:NREP 1 BL:PDB:REP 7->200|2nv0A|2e-48|54.9|182/191| RP:PDB:NREP 1 RP:PDB:REP 6->201|2abwA|1e-23|30.6|196/216| RP:PFM:NREP 1 RP:PFM:REP 10->200|PF01174|3e-57|62.8|183/184|SNO| HM:PFM:NREP 1 HM:PFM:REP 10->199|PF01174|4.3e-61|44.0|182/188|SNO| RP:SCP:NREP 1 RP:SCP:REP 7->200|1q7rA|7e-31|49.5|186/202|c.23.16.1| HM:SCP:REP 7->200|2abwA1|6.7e-50|43.9|189/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 450 OP:NHOMOORG 409 OP:PATTERN 1111111111111111-1111111222111111111111111111111111111111111-1111-11 1111111-11111-11111-11111111111111111111111112-111111111111111111-111111111111-11-1---------1-------------------------------1-----------1111111111-------------------------------------1111111-11111111111111111111111111111111111111111111111111111111111111----------------------1-------------11111111111-----------------------1--11-----1----1-11----------111122111---111111--1------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1-1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111---1-----------------------------111111111---------------------------------------------------------------------------11-1111111--- 11--1-1-1----11-11111111111111111111111111111111111111--1111111-111111-11114335211111111-12111111111111111-14--------------------------------------------------11--11--------1-1111F1111-3121111-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 98.0 SQ:SECSTR ####cEEEEEEcTTcccHHHHHTTccTTEEEEEEccHHHHHTccEEEEccccHHHHTTHHHHHHHHHHHHHHHTccccEEEETHHHHHTEEEEEcTTGGGcccccEEEEEEcccccEEEEEcEEccccTTccTTcEEEEEcccEEEEEccTTcEEEEEEEETTEEEEEEEEEETTEEEEcccGGGccccHHHHHHHHHHHH DISOP:02AL 1-3| PSIPRED ccccccEEEEEEEcccHHHHHHHHHHcccEEEEEccHHHHHHccEEEEccccHHHHHHHHHHccHHHHHHHHHHccccEEEHHHHHHHHHHHcccccccccccccEEEEEEEcccccEEEEEccccEEcccccccEEEEEEEEEEEEEcccccEEEEEEccccccccEEEEEcccEEEEEcccEEcccHHHHHHHHHHHcc //