[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56138.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  207/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->171 2eo4A PDBj 2e-15 34.1 %
:RPS:SCOP  26->178 1z84A2  d.13.1.2 * 1e-30 12.2 %
:HMM:SCOP  20->182 1emsA1 d.13.1.1 * 1.9e-42 37.3 %
:RPS:PFM   71->153 PF01230 * HIT 6e-16 43.9 %
:HMM:PFM   66->150 PF01230 * HIT 7.1e-13 35.7 84/98  
:BLT:SWISS 47->158 YHIT_SULSO 7e-12 29.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56138.1 GT:GENE AAZ56138.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2464734..2465291) GB:FROM 2464734 GB:TO 2465291 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56138.1 GB:DB_XREF GI:71916236 LENGTH 185 SQ:AASEQ MQRETRDDGEGRQVRGPDGLQRLWTPHRMAYIKGENKPHGSGPDDGCPFCRAPQLSDPEGLVLARGKTAFALLNLYPYNSGHLMVCPYRHVADYTELNEDETAEIAALTQAGITALRSAYGAQGFNVGMNLGEAAGAGIAAHLHQHVVPRWGGDTNFMPIVGQTKVLPQLLGQTREQLVAHWPKS GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 47->158|YHIT_SULSO|7e-12|29.1|110/139| BL:PDB:NREP 1 BL:PDB:REP 47->171|2eo4A|2e-15|34.1|123/149| RP:PFM:NREP 1 RP:PFM:REP 71->153|PF01230|6e-16|43.9|82/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 66->150|PF01230|7.1e-13|35.7|84/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 26->178|1z84A2|1e-30|12.2|148/156|d.13.1.2| HM:SCP:REP 20->182|1emsA1|1.9e-42|37.3|150/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 334 OP:NHOMOORG 284 OP:PATTERN 22111111222222221311111111111111-----------1111-11111-2222221---1--- 1112211211111122111-111122111112111113221111111111111111111111121111111----111-----11211--------------------1----------------21111111111111--11111---------------------111------------------11-----------------------------------------------------------------1-11-------------1----11-----------------------------------------------1-1111221-2---------1--------21-21111-----------1------------------------------------1----------------------------------------------------------------------------------1----------111111-------1-------111---------------1-11----1---------------1--11--11111211211111-1112211211212111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111111-------------------------------------1--------11- ---------------11-------1----------------------------------1-1------------------------1-----1--------------1-----1-2----1---111--421-1111--------1-1----------1------------------------1----1-1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 68.6 SQ:SECSTR ############################################cccHHHHHHTTTcccccEEEEcccEEEEEccccccTTcEEEEEccccccGGGccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccccGGGTccccccccEEEEEEccccccccTTccccHHHHHHH############## DISOP:02AL 1-6, 32-46, 184-185| PSIPRED ccccccccccEEEccccccccccccHHHHHHHHHcccccccccccccEEEEEccccccccEEEEEccEEEEEEcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcc //