[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56139.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  361/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->204 PF03741 * TerC 1e-18 40.9 %
:HMM:PFM   10->203 PF03741 * TerC 5.6e-50 44.9 176/184  
:BLT:SWISS 1->243 YOAE_ECOLI 1e-51 58.9 %
:PROS 245->255|PS01090|TATD_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56139.1 GT:GENE AAZ56139.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2465388..2466167) GB:FROM 2465388 GB:TO 2466167 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56139.1 GB:DB_XREF GI:71916237 InterPro:IPR001130 LENGTH 259 SQ:AASEQ MSADLIVGFLTLTLLEVVLGIDNLVFISILSNKLPEHQRGRARKTGIALALITRLMLLASISWIVQLTTPLFSIGSLEFSGQSLILIAGGFFLLGKGTYEIHESLEGDSGHKPVKKGAAVFGAVVAQIVVLDIVFSLDSVITAVGMINPAGWGIWVMVAAVIVAVVVMLFLANPLAEFVNKHPTVKMLALAFLLLIGMSLVAEGFHFHIEKGFIYAAMGFSVFVEVLNLLAARRRQQKQKSTPSPVKLHSRYAEDGGIA GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 1->243|YOAE_ECOLI|1e-51|58.9|236/518| PROS 245->255|PS01090|TATD_2|PDOC00836| TM:NTM 7 TM:REGION 7->29| TM:REGION 46->68| TM:REGION 75->97| TM:REGION 120->142| TM:REGION 154->176| TM:REGION 185->207| TM:REGION 211->232| SEG 84->97|liliaggffllgkg| SEG 114->130|vkkgaavfgavvaqivv| SEG 156->168|vmvaavivavvvm| RP:PFM:NREP 1 RP:PFM:REP 11->204|PF03741|1e-18|40.9|176/178|TerC| HM:PFM:NREP 1 HM:PFM:REP 10->203|PF03741|5.6e-50|44.9|176/184|TerC| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03741|IPR005496| OP:NHOMO 565 OP:NHOMOORG 364 OP:PATTERN -------------------------------------------------------------------- --------------1------------------------------1------1-----------1-----1--------111-----------------11-11-11111---------------11111-11111111-----1---------------------1----------------112-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111111111111-1-122222222222-1111111111-112211111111122-11-----------------------1-11111111111---------------1-1--1-1--233211111111----11111111-11111112-1111111----1-1-221-1-11111111111111111--11---11-----1111111-11111-1---1111111111111111111-------222--1-1---------11------1---21--1---11111133332233334334332-333334333333333333333333221333322322233333333333333-132222222122211-------1111--1--111-11-11111--111111121--3233333333-33331222-------------1-----11-1122----------------111111-----------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 103-119, 232-259| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHcccc //