[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56143.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->134 PF09656 * PGPGW 6.7e-23 55.8 52/53  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56143.1 GT:GENE AAZ56143.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2470647..2471117 GB:FROM 2470647 GB:TO 2471117 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56143.1 GB:DB_XREF GI:71916241 LENGTH 156 SQ:AASEQ MASPAHRSTGLSGVCVFSDRYPWGRVMVETMSAHPATGSDGAPSAVPAPRSRSRVRRWRRVRVHARLWRRRMRSHPALHLAWRVTVGLVGSVVLLGGVVMCVTPGPGIGGVIVGLAILATEFSWARRLLWRARDYASQARSRAAEKLRERRARTSR GT:EXON 1|1-156:0| TM:NTM 2 TM:REGION 76->98| TM:REGION 103->125| SEG 42->73|apsavpaprsrsrvrrwrrvrvharlwrrrmr| SEG 84->99|vtvglvgsvvllggvv| SEG 104->119|pgpgiggvivglaila| SEG 139->153|arsraaeklrerrar| HM:PFM:NREP 1 HM:PFM:REP 83->134|PF09656|6.7e-23|55.8|52/53|PGPGW| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 36-52, 137-156| PSIPRED ccccccccccccEEEEEcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //