[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56147.1
DDBJ      :             gluconate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  319/915 : Eukaryota  133/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:170 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->162 1ko5A PDBj 2e-21 31.9 %
:RPS:PDB   1->166 3cr8B PDBj 2e-11 15.4 %
:RPS:SCOP  3->162 1knqA  c.37.1.17 * 7e-24 38.8 %
:HMM:SCOP  1->164 1knqA_ c.37.1.17 * 4.3e-29 29.3 %
:RPS:PFM   10->157 PF01202 * SKI 3e-12 33.8 %
:HMM:PFM   9->118 PF01202 * SKI 1.6e-17 28.4 102/158  
:BLT:SWISS 6->156 GNTK_HUMAN 2e-28 45.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56147.1 GT:GENE AAZ56147.1 GT:PRODUCT gluconate kinase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2474645..2475157 GB:FROM 2474645 GB:TO 2475157 GB:DIRECTION + GB:PRODUCT gluconate kinase GB:PROTEIN_ID AAZ56147.1 GB:DB_XREF GI:71916245 InterPro:IPR006001 LENGTH 170 SQ:AASEQ MHYVFMGVSGSGKTTVARGVAQELGLPFADADDFHPEANIAKMARGIPLTDEDRLPWLQALAAWISEREREGTSSVVTCSALRRSYRDLLRRSAPGVFFLHLHGSAELIGKRIRERRGHFMPPQLLDSQFATLEPLAPDEAGAVLDVSASPEDLIAEAVRIVTGLRNAQA GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 6->156|GNTK_HUMAN|2e-28|45.7|151/187| SEG 80->93|salrrsyrdllrrs| BL:PDB:NREP 1 BL:PDB:REP 3->162|1ko5A|2e-21|31.9|160/172| RP:PDB:NREP 1 RP:PDB:REP 1->166|3cr8B|2e-11|15.4|136/493| RP:PFM:NREP 1 RP:PFM:REP 10->157|PF01202|3e-12|33.8|142/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 9->118|PF01202|1.6e-17|28.4|102/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 3->162|1knqA|7e-24|38.8|160/171|c.37.1.17| HM:SCP:REP 1->164|1knqA_|4.3e-29|29.3|164/0|c.37.1.17|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 558 OP:NHOMOORG 452 OP:PATTERN -------------------------------------------------------------------- 11--2111111111111----1--11-----111111222----11--121-2321-1----11-1121111---111--------------------------1-1-------------------------------------1-111111--------------11111--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------2111111111111----------1-11-12-1111--111321122212-11-1--1-------1111111112211-------------------------------------1-----1111111111111121111121111111--1111-1--1111---------1-1111111--------------------------------1-11-----------------------------112--11-112-1111----------1----------------11211112112221212-1121212122112222221121111112222222222212122211111121-222222222222---------------111111111-----11111111111---2111111111111111111----------1-1-1111111111--11111111-------------------------------------------------------------1- ----111-1---1111111121222221111-111-11111--11111332232211112221111111111111111-111111111-12111111-1111-111-1-1----1--1--11111111-541-113-1----1---1--11-11-1111----11------1111-1--4----11--1111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 167-170| PSIPRED cEEEEEccccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHHHccccc //