[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56152.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->54 PF08044 * DUF1707 2e-07 59.1 %
:HMM:PFM   11->63 PF08044 * DUF1707 8.4e-25 64.2 53/53  
:BLT:SWISS 8->54 Y966_MYCTU 4e-07 51.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56152.1 GT:GENE AAZ56152.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2479315..2479800 GB:FROM 2479315 GB:TO 2479800 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56152.1 GB:DB_XREF GI:71916250 LENGTH 161 SQ:AASEQ MAGEHLPEERIRASDADRDATAEQLAQALVEGRLDLAEYDKRLAAAMSATTLGELAPLTADLPPAPGSARAPVDLAAVGRAHAPARRWRDFLEPWRGFASLAVILGGIWLVTSIMAGELLYFWPGWPLGIVFVITAANALSGSARSDKDTPGDHSGPHTKA GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 8->54|Y966_MYCTU|4e-07|51.1|47/200| TM:NTM 2 TM:REGION 96->118| TM:REGION 123->145| SEG 55->66|lapltadlppap| RP:PFM:NREP 1 RP:PFM:REP 11->54|PF08044|2e-07|59.1|44/53|DUF1707| HM:PFM:NREP 1 HM:PFM:REP 11->63|PF08044|8.4e-25|64.2|53/53|DUF1707| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------1---------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 69-90, 140-161| PSIPRED ccccccccHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHccccccccccccccccccccc //