[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56166.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.18a.118.8
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->92 1na0A PDBj 2e-06 29.8 %
:RPS:PDB   9->97 2cg3A PDBj 1e-09 15.7 %
:RPS:SCOP  9->99 1ouvA  a.118.18.1 * 2e-08 5.5 %
:HMM:SCOP  2->99 1hxiA_ a.118.8.1 * 8.5e-12 24.5 %
:HMM:PFM   42->70 PF07719 * TPR_2 1.7e-07 41.4 29/34  
:HMM:PFM   9->29 PF07721 * TPR_4 0.001 28.6 21/26  
:HMM:PFM   73->96 PF07721 * TPR_4 3.6e-06 41.7 24/26  
:BLT:SWISS 37->92 MBB1_CHLRE 5e-05 42.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56166.1 GT:GENE AAZ56166.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2497537..2497863 GB:FROM 2497537 GB:TO 2497863 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56166.1 GB:DB_XREF GI:71916264 InterPro:IPR001440 LENGTH 108 SQ:AASEQ MAESNYETYRRGRQHFDLGDPIGAARVLAPLAEEEPRNRTVLELLGRSYFHSAQLAKAEEVFRKIIELDPCDAWAHIALARTLERQNRADEAAPHRRMHAIMSGGSLD GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 37->92|MBB1_CHLRE|5e-05|42.3|52/662| BL:PDB:NREP 1 BL:PDB:REP 9->92|1na0A|2e-06|29.8|84/119| RP:PDB:NREP 1 RP:PDB:REP 9->97|2cg3A|1e-09|15.7|89/617| HM:PFM:NREP 3 HM:PFM:REP 42->70|PF07719|1.7e-07|41.4|29/34|TPR_2| HM:PFM:REP 9->29|PF07721|0.001|28.6|21/26|TPR_4| HM:PFM:REP 73->96|PF07721|3.6e-06|41.7|24/26|TPR_4| RP:SCP:NREP 1 RP:SCP:REP 9->99|1ouvA|2e-08|5.5|91/265|a.118.18.1| HM:SCP:REP 2->99|1hxiA_|8.5e-12|24.5|98/0|a.118.8.1|1/1|TPR-like| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------------1---------------111-1112121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 89.8 SQ:SECSTR #####HHcHHHccccccGGGTccccHHHHHHHHHHHTcHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHHHHHHH###### DISOP:02AL 1-3, 107-108| PSIPRED cccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccc //