[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56170.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->113 PF04600 * DUF571 1.9e-07 33.7 98/425  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56170.1 GT:GENE AAZ56170.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2501863..2502216 GB:FROM 2501863 GB:TO 2502216 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56170.1 GB:DB_XREF GI:71916268 LENGTH 117 SQ:AASEQ MSSVTPYNPNIPPPPNPYTRQDPSGAAPRPPRRASRATAVLSVLLGLGVMVFAVPAAVLRTSDVMDHPLRWLALVVLLVLGPLLAFGKRPRSAQALGRGLLLGTLTGCVVAALLSWG GT:EXON 1|1-117:0| TM:NTM 3 TM:REGION 39->61| TM:REGION 66->87| TM:REGION 94->116| SEG 6->18|pynpnippppnpy| SEG 23->37|psgaaprpprrasra| SEG 40->51|vlsvllglgvmv| SEG 69->84|lrwlalvvllvlgpll| SEG 96->107|lgrglllgtltg| HM:PFM:NREP 1 HM:PFM:REP 11->113|PF04600|1.9e-07|33.7|98/425|DUF571| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 17-35| PSIPRED cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcc //