[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56174.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->55 PF09654 * DUF2396 0.00045 50.0 24/161  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56174.1 GT:GENE AAZ56174.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2508335..2508583 GB:FROM 2508335 GB:TO 2508583 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56174.1 GB:DB_XREF GI:71916272 LENGTH 82 SQ:AASEQ MLRIDQHTDMQHVTARLRNEFHTLPHRSVERCVTDTWHCARHLGFEATPSLVERVAREHLRALVESAPPSASPSAADTGLLD GT:EXON 1|1-82:0| SEG 66->76|sappsaspsaa| HM:PFM:NREP 1 HM:PFM:REP 32->55|PF09654|0.00045|50.0|24/161|DUF2396| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 66-74| PSIPRED cccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccc //