[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56187.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56187.1 GT:GENE AAZ56187.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2524819..2525475) GB:FROM 2524819 GB:TO 2525475 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56187.1 GB:DB_XREF GI:71916285 LENGTH 218 SQ:AASEQ MVQPPPPGGSATLHEEPRGSGRGCAVAVLVSAVLVLVLLGCGGVGLLVWLRGPGGDYAEAPPCALVEESGVLDQLVKGYVTDLDAPVDTQGATWWDGTQCRWTTTEDSPGMPSSVSVAFIRSGNRFGHGGEASARADLKRESEDNATTAVTGLGDEAVRWYDATTLHGCVAVRKSNLMISACYEASTDFSATREVSAEEAMDGAVSVAQEIVATLEQE GT:EXON 1|1-218:0| TM:NTM 1 TM:REGION 26->48| SEG 23->55|gcavavlvsavlvlvllgcggvgllvwlrgpgg| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 216-218| PSIPRED cccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccEEEEEEEEEcccHHHcccccccHHHHHHHHHccccEEEEEccccHHEEEEcccccEEEEEEEEEcEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccc //