[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56215.1
DDBJ      :             LSU ribosomal protein L21P
Swiss-Prot:RL21_THEFY   RecName: Full=50S ribosomal protein L21;

Homologs  Archaea  0/68 : Bacteria  418/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.155.1
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->120 1vs9P PDBj 5e-18 43.9 %
:RPS:PDB   22->122 3bboT PDBj 4e-18 29.7 %
:RPS:SCOP  22->122 1vs6R1  b.155.1.1 * 1e-25 29.7 %
:HMM:SCOP  21->122 2i2tR1 b.155.1.1 * 7.9e-26 38.2 %
:RPS:PFM   21->115 PF00829 * Ribosomal_L21p 4e-11 36.8 %
:HMM:PFM   21->115 PF00829 * Ribosomal_L21p 2.9e-28 34.7 95/96  
:BLT:SWISS 21->123 RL21_THEFY 1e-53 99.0 %
:PROS 91->113|PS01169|RIBOSOMAL_L21

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56215.1 GT:GENE AAZ56215.1 GT:PRODUCT LSU ribosomal protein L21P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2562691..2563062) GB:FROM 2562691 GB:TO 2563062 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L21P GB:PROTEIN_ID AAZ56215.1 GB:DB_XREF GI:71916313 InterPro:IPR001787 LENGTH 123 SQ:AASEQ MTAVDCERILFCSEQEVSFPVYAIVRAGGRQEKVSVDDVVTIDRVAKEAGDTLNLEPLLVVDNGKVVSDAAELNKYQVTAEVLGEVTGPKIKILKYKSKTGYKRRLGHRQKYTQIRVTGIAAK GT:EXON 1|1-123:0| SW:ID RL21_THEFY SW:DE RecName: Full=50S ribosomal protein L21; SW:GN Name=rplU; OrderedLocusNames=Tfu_2182; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 21->123|RL21_THEFY|1e-53|99.0|103/103| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 91->113|PS01169|RIBOSOMAL_L21|PDOC00899| BL:PDB:NREP 1 BL:PDB:REP 21->120|1vs9P|5e-18|43.9|98/100| RP:PDB:NREP 1 RP:PDB:REP 22->122|3bboT|4e-18|29.7|101/104| RP:PFM:NREP 1 RP:PFM:REP 21->115|PF00829|4e-11|36.8|95/96|Ribosomal_L21p| HM:PFM:NREP 1 HM:PFM:REP 21->115|PF00829|2.9e-28|34.7|95/96|Ribosomal_L21p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00829|IPR001787| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00829|IPR001787| GO:PFM GO:0005622|"GO:intracellular"|PF00829|IPR001787| GO:PFM GO:0005840|"GO:ribosome"|PF00829|IPR001787| GO:PFM GO:0006412|"GO:translation"|PF00829|IPR001787| RP:SCP:NREP 1 RP:SCP:REP 22->122|1vs6R1|1e-25|29.7|101/103|b.155.1.1| HM:SCP:REP 21->122|2i2tR1|7.9e-26|38.2|102/0|b.155.1.1|1/1|L21p-like| OP:NHOMO 421 OP:NHOMOORG 420 OP:PATTERN -------------------------------------------------------------------- 11--111111111111111-111111111111111111111111111111111111111111111111111111111111-1-1-1----------1----1-1-------------------------------------111-1-------------1-----------------------11111-----1--------------------1-------111---------11111111111111-1111---------------------1------------------------------------------------1--------------1-------1----111-111----11-11111-1-1------11--1-------------11111111111-----------------------1---1-11--1111-11--------------11------------------------------11-11111111111111111111111-11111111111-11111--111111111-111-11111111-1111-11--1--1-111-111-11-1-1111------11--------------------1----1111-1-11111111111-1111111111111----111--------11-11111-111-11-1111111111111111111111111111-11-1111111111--11111111-111111111111---111111-----1-11-11111111111111----------111111---------1------------111111111111111111111111------11---1111-----------------1-11---111-1-----------1-------- ------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 82.9 SQ:SECSTR ####################cccccccccccccccTTccccccccTccTTcEEEcTTcccccccccccccccccccccEEEcccccccccccEEEccTTTTccEEEcccccccccccccccc# DISOP:02AL 1-2| PSIPRED ccccccHHHEEEccccccEEEEEEEEEccEEEEEEcccEEEEEEEccccccEEEEEEEEEEccccEEEccEEEcccEEEEEEEEEccccEEEEEEEEcccccEEEEcEEccEEEEEEEEEEcc //