[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56219.1
DDBJ      :             Sfr protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  753/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:407 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   124->393 PF01098 * FTSW_RODA_SPOVE 5e-34 37.6 %
:HMM:PFM   43->395 PF01098 * FTSW_RODA_SPOVE 3.6e-101 39.7 350/359  
:BLT:SWISS 125->396 RODA_HAEIN 1e-30 30.3 %
:PROS 352->376|PS00428|FTSW_RODA_SPOVE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56219.1 GT:GENE AAZ56219.1 GT:PRODUCT Sfr protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2569472..2570695) GB:FROM 2569472 GB:TO 2570695 GB:DIRECTION - GB:PRODUCT Sfr protein GB:PROTEIN_ID AAZ56219.1 GB:DB_XREF GI:71916317 InterPro:IPR001182 LENGTH 407 SQ:AASEQ MIRKARMSLRFAQAMRLPAPLPHVSQVAARMLPRHLDGVLLGAAVTLSMVGALLVWSATLPPTGHAGPTVYAWRHLGHLLLALPLCLALASLTRRALRAYTPVLFVAVTVALLLVLGPLGETVNGSRSWIALGDLRVQPAETAKIALILAVAAVLGRPRPRTPRPPASDVLISLGVAAVPIGLILLQPDLGSALVLTAIYLALLACSGAPLRWPLALLGCGAFTGLAVWQLGLLKDYQVARFTAFLDPHADPLGAGYNVNQALIAVGSGGLSGSGLFHGGQTSGKFVPEQHTDFVFSVAAEELGFAGGCAVIVLLGVVLLRILRVASRCDEVHGRLVCIGVAAWFCVQVFVNIGMTLGLTPVTGLPLPFVSYGGSAAVANFAALGLVMAVHAHNEERRSLEPAGTRG GT:EXON 1|1-407:0| BL:SWS:NREP 1 BL:SWS:REP 125->396|RODA_HAEIN|1e-30|30.3|267/371| PROS 352->376|PS00428|FTSW_RODA_SPOVE|PDOC00352| TM:NTM 10 TM:REGION 31->53| TM:REGION 72->93| TM:REGION 102->124| TM:REGION 133->155| TM:REGION 177->199| TM:REGION 214->236| TM:REGION 254->276| TM:REGION 299->321| TM:REGION 340->362| TM:REGION 370->391| SEG 76->99|lghlllalplclalasltrralra| SEG 102->123|pvlfvavtvalllvlgplgetv| SEG 145->155|ialilavaavl| SEG 157->166|rprprtprpp| SEG 267->280|gsgglsgsglfhgg| SEG 311->325|vivllgvvllrilrv| SEG 354->368|gmtlgltpvtglplp| RP:PFM:NREP 1 RP:PFM:REP 124->393|PF01098|5e-34|37.6|266/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 43->395|PF01098|3.6e-101|39.7|350/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1347 OP:NHOMOORG 754 OP:PATTERN -------------------------------------------------------------------- 222122------1-21111-11111-1111112---21222222---11------1-111--1-1-11232-------3211322111111111111----111-1-1111111111112111111121111211123334---222212221222222122211112222221-22222-221--111123343333344454445444366324443334322555555331222222222222223222211212212212221122-2211-111111----21111111111111-------------11122211112432344444442432233322223312322223332222212333211112-2112-----------11-1---11111111111-11-11-1---2-1--1------11-11121222222121111111111222211111--------11111111111111111111111122222212211111111111111111111111112222212122221122112222222111111122222222221211222222222222221222122222--111-------------1------222222222222222222223222222322221-211221--11122222222222222222-223222222222212222222222222222222222222222222222222212222222222222222111112222222222222222222222222222222222222222222212222222211111111123332222223322233222222222222112111----1111121222--------------------------11111-11-1211 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 392-407| PSIPRED cccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //