[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56228.1
DDBJ      :             trigger factor
Swiss-Prot:TIG_THEFY    RecName: Full=Trigger factor;         Short=TF;

Homologs  Archaea  0/68 : Bacteria  832/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.223.1d.241.2d.26.1
:463 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->312 1t11B PDBj 2e-34 30.3 %
:RPS:PDB   12->110 2d3o1 PDBj 2e-19 30.6 %
:RPS:PDB   159->306 3cgnA PDBj 5e-14 17.6 %
:RPS:SCOP  2->115 1omsA  d.241.2.1 * 2e-22 21.2 %
:RPS:SCOP  140->264 1jvwA  d.26.1.1 * 5e-13 11.3 %
:RPS:SCOP  245->426 1w26A1  a.223.1.1 * 3e-19 19.8 %
:HMM:SCOP  1->128 1t11A2 d.241.2.1 * 4.2e-39 47.2 %
:HMM:SCOP  133->244 1w26A3 d.26.1.1 * 3.1e-22 33.9 %
:HMM:SCOP  245->438 1w26A1 a.223.1.1 * 4.6e-40 35.4 %
:RPS:PFM   1->124 PF05697 * Trigger_N 4e-18 41.1 %
:RPS:PFM   160->215 PF00254 * FKBP_C 4e-04 39.2 %
:RPS:PFM   259->419 PF05698 * Trigger_C 2e-14 29.8 %
:HMM:PFM   1->146 PF05697 * Trigger_N 1.1e-44 44.1 145/145  
:HMM:PFM   258->418 PF05698 * Trigger_C 3.7e-37 31.1 161/162  
:HMM:PFM   157->215 PF00254 * FKBP_C 6e-09 28.8 59/96  
:BLT:SWISS 1->445 TIG_THEFY 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56228.1 GT:GENE AAZ56228.1 GT:PRODUCT trigger factor GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2577887..2579278) GB:FROM 2577887 GB:TO 2579278 GB:DIRECTION - GB:PRODUCT trigger factor GB:PROTEIN_ID AAZ56228.1 GB:DB_XREF GI:71916326 InterPro:IPR001179 InterPro:IPR005215 LENGTH 463 SQ:AASEQ MKTAVEELSPTRVKLTIEVPFEELDHAFDVTYKSLAKQVRIKGFRPGKAPAKLIDRYVGRGAVLTQAVNHAVPELYSEAVSKEEVPVLGPPEVEITRLEDGKELAFTAEVDVRPKFEVTDYEGIEVTVDDAEVTEEQVNERLEALRQRFATLIGVDRPAEQGDHVSIDLSASVDGKKLEDAQASGVSYEIGAGTLLQGLDEAIIGLSAGESATFTTTLVGGEHKGREADVTVTVHSVKLKELPELDDEFARLASEFDTIEELRASEAERLGELLRAQQLRQARDRVLEKLVDSIDIPLPESVIKQEADRRRELLDRQLSQSGLSKEAYLEAQEKTEEEFEAELTENATRAVKTGFVLDQLASQENLTASNEELTQYVVEQAQSMGISPDQLFQSLMQANQLQLVYVEVLRAKALDLVVSKAKITDESGNTIEPPTPVHTETITVASGDEETEESAAEQGETEK GT:EXON 1|1-463:0| SW:ID TIG_THEFY SW:DE RecName: Full=Trigger factor; Short=TF; SW:GN Name=tig; OrderedLocusNames=Tfu_2195; SW:KW Cell cycle; Cell division; Chaperone; Complete proteome; Isomerase;Rotamase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->445|TIG_THEFY|0.0|100.0|445/463| GO:SWS:NREP 5 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|Rotamase| GO:SWS GO:0006457|"GO:protein folding"|Rotamase| SEG 83->94|eevpvlgppeve| SEG 125->138|evtvddaevteeqv| SEG 273->283|llraqqlrqar| SEG 330->348|eaqekteeefeaeltenat| SEG 446->462|sgdeeteesaaeqgete| BL:PDB:NREP 1 BL:PDB:REP 1->312|1t11B|2e-34|30.3|307/374| RP:PDB:NREP 2 RP:PDB:REP 12->110|2d3o1|2e-19|30.6|98/100| RP:PDB:REP 159->306|3cgnA|5e-14|17.6|142/151| RP:PFM:NREP 3 RP:PFM:REP 1->124|PF05697|4e-18|41.1|124/146|Trigger_N| RP:PFM:REP 160->215|PF00254|4e-04|39.2|51/91|FKBP_C| RP:PFM:REP 259->419|PF05698|2e-14|29.8|161/161|Trigger_C| HM:PFM:NREP 3 HM:PFM:REP 1->146|PF05697|1.1e-44|44.1|145/145|Trigger_N| HM:PFM:REP 258->418|PF05698|3.7e-37|31.1|161/162|Trigger_C| HM:PFM:REP 157->215|PF00254|6e-09|28.8|59/96|FKBP_C| GO:PFM:NREP 5 GO:PFM GO:0006457|"GO:protein folding"|PF05697|IPR008881| GO:PFM GO:0015031|"GO:protein transport"|PF05697|IPR008881| GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| GO:PFM GO:0006457|"GO:protein folding"|PF05698|IPR008880| GO:PFM GO:0015031|"GO:protein transport"|PF05698|IPR008880| RP:SCP:NREP 3 RP:SCP:REP 2->115|1omsA|2e-22|21.2|113/115|d.241.2.1| RP:SCP:REP 140->264|1jvwA|5e-13|11.3|124/160|d.26.1.1| RP:SCP:REP 245->426|1w26A1|3e-19|19.8|172/185|a.223.1.1| HM:SCP:REP 1->128|1t11A2|4.2e-39|47.2|127/129|d.241.2.1|1/1|Trigger factor ribosome-binding domain| HM:SCP:REP 133->244|1w26A3|3.1e-22|33.9|112/116|d.26.1.1|1/1|FKBP-like| HM:SCP:REP 245->438|1w26A1|4.6e-40|35.4|181/0|a.223.1.1|1/1|Triger factor/SurA peptide-binding domain-like| OP:NHOMO 859 OP:NHOMOORG 841 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-111111111111111111111111111111111111111111111111111111111111211--111-------------------------------11111-1111-1111-11--11111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111311111221122111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-111111111111111111111111111----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111-11111111-111111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111--111111--1--11111111-1--111-1111111-11-111-1----1---111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---8-----2112-11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 70.4 SQ:SECSTR cEEEEEEccTTcEEEEEcccGGGTHHHHHHHHHHHHTTcccTTccTTccccTTHHHHTTTTccHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccEEEEEEcccccccTTcTTcEEEccccccTHHHH#ccccccccccccccEEEccccTTEEEEEEEEEEETTEEEEEccTEEEEEETTcccccHHHHHHHTTccTTcEEEEEEcGGGTTcccGGGEEEEcGGGccccccccTTcEEcccccccccEHHccEEEEEEETTEEEEEcccTTTTccEEEEEEEEEEEccHHHHHHTHHHHHHHHHHHHHTTccTTcc######################################################################################################################################## DISOP:02AL 318-322, 324-326, 441-463| PSIPRED ccEEEEEEcccEEEEEEEEcHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccEEEEEEEEEcccEEcccccccEEEEEcccccHHHHHHHHHHHHHHccccccccHHHHcccEEEEEEEEEEccEEccccccccEEEEEccccccHHHHHHHcccccccEEEEEcccccHHHccccEEEEEEEEEEcccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEcccHHHccccccccccccccccccHHHHccccccccc //