[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56241.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.51.1
:270 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  205->266 2nn6H3  d.51.1.1 * 1e-05 18.6 %
:RPS:PFM   109->166 PF08378 * NERD 2e-06 34.5 %
:HMM:PFM   108->208 PF08378 * NERD 8.6e-09 19.0 100/125  
:HMM:PFM   48->97 PF01040 * UbiA 4.4e-05 23.4 47/258  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56241.1 GT:GENE AAZ56241.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2597348..2598160 GB:FROM 2597348 GB:TO 2598160 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56241.1 GB:DB_XREF GI:71916339 LENGTH 270 SQ:AASEQ MESATSTRPDDPSRTSETQRDDAPPSFHRPTSKPVAPHTDTLMRTYRSLLKHGVVRRWLPRVAACLVAAVVVGVLFSSWRVGVTAGAAALVGFIVYTSQRQSEVPQWRKPSSAQRRTEAQLRIMQRFGYRVLHARRIQDGNGQIDHFIVGRRGAFAIDSEAWDKRLPLRNKLEKLYHGRFSKNERIDEALAEARNAERLISEELGRPIKVRAALAIYGPSMPWDSHRLRGVDIIVGTKVRKWLRSGKDRLTEEEIEEIYQAAKKVLPPMY GT:EXON 1|1-270:0| TM:NTM 1 TM:REGION 58->79| SEG 62->74|vaaclvaavvvgv| SEG 81->92|vgvtagaaalvg| SEG 188->199|ealaearnaerl| RP:PFM:NREP 1 RP:PFM:REP 109->166|PF08378|2e-06|34.5|58/121|NERD| HM:PFM:NREP 2 HM:PFM:REP 108->208|PF08378|8.6e-09|19.0|100/125|NERD| HM:PFM:REP 48->97|PF01040|4.4e-05|23.4|47/258|UbiA| RP:SCP:NREP 1 RP:SCP:REP 205->266|2nn6H3|1e-05|18.6|59/120|d.51.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1--------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-28, 102-119| PSIPRED ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccEEEccHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccccccccEEEEEcHHHHHHHHccHHcccHHHHHHHHHHHHHHccccc //