[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56285.1
DDBJ      :             putative molybdopterin-guanine dinucleotide biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->71 PF06912 * DUF1275 0.00057 26.7 45/209  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56285.1 GT:GENE AAZ56285.1 GT:PRODUCT putative molybdopterin-guanine dinucleotide biosynthesis protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2652654..2652899) GB:FROM 2652654 GB:TO 2652899 GB:DIRECTION - GB:PRODUCT putative molybdopterin-guanine dinucleotide biosynthesis protein GB:PROTEIN_ID AAZ56285.1 GB:DB_XREF GI:71916383 LENGTH 81 SQ:AASEQ MTLVEWARLVCAELELSEEIDTDDVNLILDLARDAAHSVARPAAPLTAYLLGIAVGRGADPQRTARLLSELALAQTKKTNK GT:EXON 1|1-81:0| HM:PFM:NREP 1 HM:PFM:REP 27->71|PF06912|0.00057|26.7|45/209|DUF1275| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------1111-----------------------------1-1-----------------1-------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-81| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccc //