[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56289.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:303 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  27->125 1s7bA_ f.39.1.1 * 0.00067 22.2 %
:HMM:PFM   4->122 PF05653 * DUF803 2.5e-09 21.8 119/300  
:HMM:PFM   103->155 PF08566 * Pam17 0.0001 26.4 53/175  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56289.1 GT:GENE AAZ56289.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2657558..2658469 GB:FROM 2657558 GB:TO 2658469 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56289.1 GB:DB_XREF GI:71916387 LENGTH 303 SQ:AASEQ MIWAVVLALVGAFCLALGSALQERDAIRAPGGSVARISFLWHLVRRPRWLLGALAAAVGVGLHLAALSAAPLTIIQPIGVSGLLFAIVLSALFSRQRVRASQLLAGVAVMVGLVGIITLFPHGADSPMLPLSAAVTLASGVVAAGGVGYLVAPWLPAGARAILLAAFGGAALGTTSALARVIAVQAVADLAAVFSWLTVLAGAVAVFGGLLQQNAYRTGHFAAAYATLLVVDPVVGAGIGVLVLGEHVPTGPLEQALAAGAALLAIAGTTVLARAKHRNPEAAHPGTASSPSNVVRTTPGDSP GT:EXON 1|1-303:0| TM:NTM 9 TM:REGION 1->23| TM:REGION 48->70| TM:REGION 73->95| TM:REGION 100->122| TM:REGION 130->152| TM:REGION 162->184| TM:REGION 191->213| TM:REGION 223->245| TM:REGION 253->274| SEG 50->70|llgalaaavgvglhlaalsaa| SEG 103->115|llagvavmvglvg| SEG 131->152|lsaavtlasgvvaaggvgylva| SEG 157->179|agaraillaafggaalgttsala| SEG 234->245|vvgagigvlvlg| SEG 256->273|alaagaallaiagttvla| HM:PFM:NREP 2 HM:PFM:REP 4->122|PF05653|2.5e-09|21.8|119/300|DUF803| HM:PFM:REP 103->155|PF08566|0.0001|26.4|53/175|Pam17| HM:SCP:REP 27->125|1s7bA_|0.00067|22.2|99/106|f.39.1.1|2/3|Multidrug resistance efflux transporter EmrE| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 27-35, 276-303| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEccccccc //