[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56298.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.84.1
:167 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  58->163 2sicI_ d.84.1.1 * 9.9e-19 31.7 %
:HMM:PFM   89->145 PF00720 * SSI 2e-05 26.4 53/95  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56298.1 GT:GENE AAZ56298.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2667613..2668116) GB:FROM 2667613 GB:TO 2668116 GB:DIRECTION - GB:PRODUCT putative secreted protein GB:PROTEIN_ID AAZ56298.1 GB:DB_XREF GI:71916396 LENGTH 167 SQ:AASEQ MSKLGVRGNSLTTVGTAVLGSLCLGGAVVYTAVVGASFAAESGIRTEAAAQTMSGLSELPEPPVATLEVRVDDGEEIYEQQLHCSGDPLTDPEACAQLAANSEEDDKAGPFEEVAPGAICADTVYGPETAVISGVWNGVAIDTEVTRVDSCEEARWQRLKPLVEPQE GT:EXON 1|1-167:0| TM:NTM 1 TM:REGION 16->38| SEG 25->36|ggavvytavvga| HM:PFM:NREP 1 HM:PFM:REP 89->145|PF00720|2e-05|26.4|53/95|SSI| HM:SCP:REP 58->163|2sicI_|9.9e-19|31.7|101/107|d.84.1.1|1/1|Subtilisin inhibitor| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 45-47, 50-57, 165-167| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHcccccHHHcccccccccccEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHcccccccccccccccEEEEEEcccEEEEEEEEEccEEccccEEccccccHHHHHcccccccccc //