Thermobifida fusca YX (tfus0)
Gene : AAZ56313.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56313.1 GT:GENE AAZ56313.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2684112..2684816 GB:FROM 2684112 GB:TO 2684816 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56313.1 GB:DB_XREF GI:71916411 LENGTH 234 SQ:AASEQ MRLTLKSPSADEQGQASLLLLIGMMLSLLALMLLFIRLGDAHQLRSRAQTAADAAALAAVTVARDNAAAMLARRQIPYYRLYDPARGRAQAEKYAQKNGAILEDIRASDNHMGQVGNFVRVEIRGANCRKELLEDRSRGWSDSVCDGTEPEDEEGLVHIGNAAAIAEMVIPDCNYVFGASHQIIGVSCEGQMIQSEQHARQLIDIRLVSKEGQYLYKPFGVADSDDEEDEDPQP GT:EXON 1|1-234:0| TM:NTM 1 TM:REGION 17->39| SEG 16->39|aslllligmmlsllalmllfirlg| SEG 47->69|raqtaadaaalaavtvardnaaa| SEG 223->231|dsddeeded| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 91-93, 222-234| PSIPRED cEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccHHHHHcccccHHccccEEEEEEEcccHHHHHHHHHHccccccccccccccccccEEEEccHHHHHHHHcccccEEEccccEEEEEEcccHHHHHHHHHHHHHHHEEEcccccEEEEccccccccccccccccc //