[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56348.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  302/915 : Eukaryota  60/199 : Viruses  0/175   --->[See Alignment]
b.69.2b.69.3
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->347 3fgbB PDBj 2e-29 30.8 %
:RPS:PDB   48->121 3dr2B PDBj 1e-04 12.9 %
:RPS:PDB   92->235 2cn3A PDBj 8e-04 11.2 %
:RPS:SCOP  77->296 1jmxB  b.69.2.2 * 4e-11 15.2 %
:HMM:SCOP  2->315 1fwxA2 b.69.3.1 * 4e-36 26.6 %
:RPS:PFM   49->330 PF10282 * Muc_lac_enz 3e-39 45.5 %
:HMM:PFM   7->348 PF10282 * Muc_lac_enz 1e-98 41.5 335/345  
:BLT:SWISS 8->347 YKGB_BACSU 2e-40 31.3 %
:REPEAT 3|93->162|200->262|297->353
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56348.1 GT:GENE AAZ56348.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2721869..2722930) GB:FROM 2721869 GB:TO 2722930 GB:DIRECTION - GB:PRODUCT putative secreted protein GB:PROTEIN_ID AAZ56348.1 GB:DB_XREF GI:71916446 LENGTH 353 SQ:AASEQ MTRRRLLWIGSYTPDSGIAGHAAGVQRVWFDTDTAALSKAELAAPASGPSFVVPATDQTMVYAVNELAAGRVTAFAVHDTQQLTEAGSAITGGSYPCHLLYHPAGRHLIVANYGDGSVSVHALDPAGVPTAPVQRLTHTGAGPRTDRQEGPHAHSVYVAPGGTHLLVVDLGTDELRCFPFAPEADQPAGPQHIAARLEPGSGPRHLAIHSSGHLYVAGELDSRVYVLRFDPATAQAEILDAVPATGAADDNYPAEIALSADERRLYVANRGADTIATFEVSADGTRIRRLADTPTGGAWPRHFALVDGYLVVANQNSETLTVLPIDAESGIPGPACSTLDLPTPVCVLPAAVE GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 8->347|YKGB_BACSU|2e-40|31.3|329/349| NREPEAT 1 REPEAT 3|93->162|200->262|297->353| SEG 35->47|aalskaelaapas| BL:PDB:NREP 1 BL:PDB:REP 49->347|3fgbB|2e-29|30.8|289/347| RP:PDB:NREP 2 RP:PDB:REP 48->121|3dr2B|1e-04|12.9|62/297| RP:PDB:REP 92->235|2cn3A|8e-04|11.2|125/728| RP:PFM:NREP 1 RP:PFM:REP 49->330|PF10282|3e-39|45.5|268/311|Muc_lac_enz| HM:PFM:NREP 1 HM:PFM:REP 7->348|PF10282|1e-98|41.5|335/345|Muc_lac_enz| RP:SCP:NREP 1 RP:SCP:REP 77->296|1jmxB|4e-11|15.2|198/339|b.69.2.2| HM:SCP:REP 2->315|1fwxA2|4e-36|26.6|297/459|b.69.3.1|1/1|Nitrous oxide reductase, N-terminal domain| OP:NHOMO 454 OP:NHOMOORG 363 OP:PATTERN ---------------------------1---------------------------------------- 2-2-2---------------------------------1-----121-111111---1--11-11-22221---------1-------1121--------12-1-2-2-1-----------------------------------------------------------------------------------11111111111111111-1111112----2--111111-21111111111111111111111111112111111111111211111-------1--11111111111-------------111---1111---11-------1-------1111-----1--------------------1-2-----------111---------------------------1----1-------------1------------11111111-111-----------------------------------1--------333212211111113111111211------113-----1-1-2----------------------------------------------------1-----------------------------1----1------------------------1------------1112-211111111111-1111111111111--11-1222221111111111111111111211111111-2111111-1111--1------------------------------111111----1-11111112-11111222-------------------11111------------------11--------------1------------------------------------2- ------2--------111111111113------1111111-11---11333332332111-----------------------------1411111-111-3-1-1-13------------------------------------------------------------------1---2---------2-11-5456- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 96.0 SQ:SECSTR ##EEEEEE#EEccccc#####ccEEEEEEEETTTTEEEEEEEEEEcccccEEccccccEEccHHHHHHHTTcccEEEEEETTEEEEEEEEcccccEEEEEEEGGGTEEEEEETTTTEEEEEETTTTcccccccTEEEEccTTccGGGGGGGcEEEEEEccccTTcEEEETEEEccccccccccccEEcccccEEEEcccccccEEEEccccccTTcTTTTccccEEEEEccccTTEEEccccccccEEEccEEEEEEEcTTccEEEEEEccccEEEEEEEcTTTcEEEEEEEEEEccccEEEEEEcTTEEEEEETTTTEEEEEEEcTTTccEEEccccEEcccEEEE###### DISOP:02AL 353-354| PSIPRED cccEEEEEEEEcccccccccccccEEEEEEEccccEEEEccEEcccccccEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEEEccccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEEEcccccccccEEEEEEEcccccccEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEEEEcccccccccEEEEEEcccccEEEEEccccccEEEEEEEccccEEEEEEEEEcccccccEEEEcccEEEEEccccccEEEEEEEccccEEEEEEccEEcccEEEEEEcccc //