[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56352.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:337 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   293->334 PF03748 * FliL 5e-05 33.3 42/149  
:HMM:PFM   29->173 PF04600 * DUF571 0.00021 23.0 135/425  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56352.1 GT:GENE AAZ56352.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2728330..2729343) GB:FROM 2728330 GB:TO 2729343 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56352.1 GB:DB_XREF GI:71916450 LENGTH 337 SQ:AASEQ MGNGRNTAESRSKALHALVAQGTLSAEQAEAVAQALQEAEEPDTPVRWAEIIGFIGGGLVFVGMVSLLYTWVDLEKLGQAVLLLTVAALAAGGGLFATGGRFRNRAALPPTRRRVGGTLFVIAALAVPTALTVALEPVNPTTAAALGLLYLALAVLAYTAAPTAVGLLVAGGTSLWALWTILAKFDLLDTDIRPYALSVVAVGLVWGVVSLRLPNPRTGLVMAAIFALGGAQIHLGDHPVLAYTLTAAIAVLSLVLYQWQRRWVFLVTGVLGITIAAPEAIWDWTDGAVSGALLMLIVGLVLLAASGVGIMLHRKTDKQPAQQAAEPPAGNAEGPAR GT:EXON 1|1-337:0| TM:NTM 9 TM:REGION 48->70| TM:REGION 79->100| TM:REGION 115->137| TM:REGION 140->162| TM:REGION 166->188| TM:REGION 192->213| TM:REGION 219->241| TM:REGION 250->272| TM:REGION 290->312| SEG 26->41|aeqaeavaqalqeaee| SEG 51->63|iigfiggglvfvg| SEG 77->100|lgqavllltvaalaaggglfatgg| SEG 123->135|aalavptaltval| SEG 140->165|pttaaalgllylalavlaytaaptav| SEG 196->210|alsvvavglvwgvvs| SEG 291->305|gallmlivglvllaa| SEG 319->336|qpaqqaaeppagnaegpa| HM:PFM:NREP 2 HM:PFM:REP 293->334|PF03748|5e-05|33.3|42/149|FliL| HM:PFM:REP 29->173|PF04600|0.00021|23.0|135/425|DUF571| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 315-337| PSIPRED cccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccHHHHHcHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHcccccccccccccc //