[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56370.1
DDBJ      :             ABC-type glucosylglycerol transport system substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:448 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   139->303 2b3bB PDBj 9e-10 26.7 %
:RPS:PDB   55->434 2b3bA PDBj 4e-25 14.4 %
:RPS:SCOP  53->446 1eu8A  c.94.1.1 * 5e-24 12.8 %
:HMM:SCOP  23->450 1eljA_ c.94.1.1 * 1.5e-46 23.1 %
:RPS:PFM   64->219 PF01547 * SBP_bac_1 8e-12 31.3 %
:HMM:PFM   75->360 PF01547 * SBP_bac_1 1.2e-24 20.3 256/314  
:HMM:PFM   10->68 PF03971 * IDH 0.00064 32.2 59/735  
:BLT:SWISS 44->448 AGLE_RHIME 2e-70 35.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56370.1 GT:GENE AAZ56370.1 GT:PRODUCT ABC-type glucosylglycerol transport system substrate-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2751783..2753129 GB:FROM 2751783 GB:TO 2753129 GB:DIRECTION + GB:PRODUCT ABC-type glucosylglycerol transport system substrate-binding protein GB:PROTEIN_ID AAZ56370.1 GB:DB_XREF GI:71916468 LENGTH 448 SQ:AASEQ MPKFPDPRVTIAATLSLVLLTGGCAYLSGGGGSAGADPDSPECEPYKQWQDIGGTVSIYASIRDVEAERLERAWQKFVDCTGIKIQYEGSGEFEAQVQVKVDGGNAPDIAFFPQPGLLERFAKSGDLVAAPESVQKLAEEGWSEDWLDYATFDGELYGTPLGANFKSFVWYSPTFFSENGYEVPQTWDELIELSDTIADDGVKPWCVGFESGDATGWPGTDWIENVVLRENGPDVYDQWVNHDIPFNDSKIADAFDRADTILRNPDYVNGGFGNVQSIAITSFQEGGLPILDGQCAMYLMGSFYSAQWPEGTEVAEDGDVYAFNLPPINPDQGTPVMGGGEFVGAFSDRPEVVAVREYLATAEFANSRAAEGAWFSAHKGLDLDLLEVPTDRLGAEILRDPETVFRFDGSDLMPAEVGAGTFWRGMVNWINGEDTDATLDYIENSWSS GT:EXON 1|1-448:0| BL:SWS:NREP 1 BL:SWS:REP 44->448|AGLE_RHIME|2e-70|35.3|399/458| SEG 28->41|sggggsagadpdsp| BL:PDB:NREP 1 BL:PDB:REP 139->303|2b3bB|9e-10|26.7|150/391| RP:PDB:NREP 1 RP:PDB:REP 55->434|2b3bA|4e-25|14.4|362/392| RP:PFM:NREP 1 RP:PFM:REP 64->219|PF01547|8e-12|31.3|147/282|SBP_bac_1| HM:PFM:NREP 2 HM:PFM:REP 75->360|PF01547|1.2e-24|20.3|256/314|SBP_bac_1| HM:PFM:REP 10->68|PF03971|0.00064|32.2|59/735|IDH| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 53->446|1eu8A|5e-24|12.8|383/407|c.94.1.1| HM:SCP:REP 23->450|1eljA_|1.5e-46|23.1|360/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 173 OP:NHOMOORG 120 OP:PATTERN 11--1-----------1-1-1-----------------------------------2---1------- ----3--------------------1-------------1----322-122-212--1--111-21-3512--11-1-----1-----------------------------------------------------12211---11-----------------11-------------------1----1-------------------12--1----112-11--------5-----------------------------------------------------1--111-1-1-111------------------------1--1----------4----1111------1--------3---------------------------------------------1---------22--411311112133-----111111132---------------------------------------------------------111111-----11-1111----1--------------------------------------------------1--1----------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------1-2--------------------------------------------------------------------------------------------------------------------------------12-11-3-2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 88.6 SQ:SECSTR #################################################cccccEEEEEEcccGGGcHHHHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHTTccccEEEETTHHHHHHTTTTTcccccHHHHHHHTHHHccHHHHHHTEETTEEccEEcccEEccEEEEcHHHHHHTTccccccHHHHHHHHHHHHHTTccccccccGEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTcHHHHHHHHHHHHHHTTccTTGGGccHHHHHHGccHHHHHHHHHHTcccEEEccTHHHHHHHHHHTTccccTTTcEEEEcTTcTTEEEEEcEEEcccTTcTHHHHHHHHHHHTcHHHHHHHHHHHccccccTTcHcGGGccHHHHHHHHHHHHcEEEEcTTTTccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHH## DISOP:02AL 1-5, 28-43, 447-448| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccccccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEEEEccHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHEEccEEEEEEEEEccEEEEEEcHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEccccHHHHHHHcccccccccEEEEEccccccccccEEEEEHHEEEEEcccHHHHHHHHHHHcHHHHHHHHHHccccccccccccHHcccHHHHHHHHHHHccccEEEcccHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcc //