[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56374.1
DDBJ      :             Protein-tyrosine-phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  536/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->160 1u2qA PDBj 8e-31 47.6 %
:RPS:PDB   12->164 1c0eA PDBj 7e-44 34.4 %
:RPS:SCOP  14->164 1c0eA  c.44.1.1 * 7e-51 34.9 %
:HMM:SCOP  8->165 1d1qA_ c.44.1.1 * 6.7e-45 45.9 %
:RPS:PFM   13->161 PF01451 * LMWPc 6e-24 48.9 %
:HMM:PFM   14->162 PF01451 * LMWPc 3.4e-39 41.6 137/140  
:BLT:SWISS 13->161 PTPA_STRCO 6e-41 52.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56374.1 GT:GENE AAZ56374.1 GT:PRODUCT Protein-tyrosine-phosphatase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2756206..2756721) GB:FROM 2756206 GB:TO 2756721 GB:DIRECTION - GB:PRODUCT Protein-tyrosine-phosphatase GB:PROTEIN_ID AAZ56374.1 GB:DB_XREF GI:71916472 InterPro:IPR000106 LENGTH 171 SQ:AASEQ MSLPEPRNPSGPYRICVVCLGNICRSPMAEKILLTDLARAGLADRVQVDSAGTGNWHVGADMDRRAASTLRKYGYPTGHVARQFSPSWFPERDLILAMDTDNLADLVRLAPDEETKDRIRLFRSFAPGVGPNPEVPDPYYGGEDGFITVLTMIEAASKGLVGELTALFSAR GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 13->161|PTPA_STRCO|6e-41|52.3|149/164| BL:PDB:NREP 1 BL:PDB:REP 12->160|1u2qA|8e-31|47.6|145/155| RP:PDB:NREP 1 RP:PDB:REP 12->164|1c0eA|7e-44|34.4|151/154| RP:PFM:NREP 1 RP:PFM:REP 13->161|PF01451|6e-24|48.9|137/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 14->162|PF01451|3.4e-39|41.6|137/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 14->164|1c0eA|7e-51|34.9|149/154|c.44.1.1| HM:SCP:REP 8->165|1d1qA_|6.7e-45|45.9|157/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 801 OP:NHOMOORG 700 OP:PATTERN -------------------------------------------------------------------- ----111122111111111-11--11111111111111111--11121111-211111----1111111-111111111-111-----1111-111---11111111-11--------------1111111---1111111---1-11111111111111111111111111111111111111--11---111111111111111111-11111111111-1--11111111-1111111111111-111111111--1-111--11--------111111111111-11111111111111111111111111-1111111-----------------------1-----1-1-----1-----------1----11------1--------------11--11111-11-1111-11--111-11111-----1-11--1211-11---------11-1111------------------------------11111111111111111111111211111112112-11-----111--1--22---31---1111111111111111-----------------------1111---------111111-1--------1-------11111-11-111111111111111-1-1---1111------11---21222-211122-22221212122112222211-111---111111111111111-122122221----------------1----------1111----1-------11111111111112111111122111112---1111111111---22222212222111111111111111---111111-----------------------------1------------------1 ----11-----11111111-1111-1-111111111111111111-111111111111111111111111111111111111111111-121111111111-1111-2-111211321111-1121121573-2221-11-1152-111-11241121123--11117224111-111-----111112111---111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 92.4 SQ:SECSTR ########ccccEEEEEEEcccccHHHHHHHHHHHHHHHTTcGGGEEEEEEEcccTTTTccccHHHHHHHHHTTcccccccccccTTHHHHccEEEEccHHHHHHHHHHTTcTTcccEEEEGGGGcTTccccccccccTTccHHHHHHHHHHHHHHHHHHHTTcHc##### DISOP:02AL 1-10, 169-171| PSIPRED cccccccccccccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccHHHHHHHHHcccccccccccccHHHHHHccEEEEEcHHHHHHHHHHcccccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //