[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56387.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  112/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->130 2a4xA PDBj 3e-12 14.8 %
:RPS:SCOP  1->131 1twuA  d.32.1.8 * 2e-11 9.4 %
:HMM:SCOP  1->129 1q0oA2 d.32.1.3 * 1.1e-19 25.9 %
:HMM:PFM   7->124 PF00903 * Glyoxalase 6.8e-07 27.0 111/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56387.1 GT:GENE AAZ56387.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2770505..2770909) GB:FROM 2770505 GB:TO 2770909 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56387.1 GB:DB_XREF GI:71916485 LENGTH 134 SQ:AASEQ MTRKIFVNVAVQDLQKSQEFFTALGFRFDPRFTDTNAACMVINDDCAVMLLTRDFFRRFTRKELVDAAKNTESIISVSADRKEEVDELVNRAFEAGARPSIDPIENEGMYAWGFQDLDGHLWEVVWMDPRALEA GT:EXON 1|1-134:0| SEG 52->61|trdffrrftr| RP:PDB:NREP 1 RP:PDB:REP 7->130|2a4xA|3e-12|14.8|122/131| HM:PFM:NREP 1 HM:PFM:REP 7->124|PF00903|6.8e-07|27.0|111/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->131|1twuA|2e-11|9.4|128/137|d.32.1.8| HM:SCP:REP 1->129|1q0oA2|1.1e-19|25.9|116/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 133 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------1------------------ --------111---1---------------------1221---11----12-111-----------11111-------------------------1----3----21-1----------------------------------1------------------------1----------------------------------------1--1-------1---11111132-11111111111111-----1----------------------111----------------------------------------------------------------------------------------------1-----1-------2---------1----------1----------1---11---11--11--------1111----------------------------------------------------2--1111111111-----1111------1-1111------11---111-1---------------------1-2-------------------------1-12------------------------------------------------1111----1----------------------------------------------------------------------------1-----------------------------------------------------------------1-----------------------------------------11----------------------------------------------------------------------- ------------------------------------1----11-----11---1--------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEccHHHHHHHHHTTccccGGGGGccEEEEEcTTccEEEEEEHHHHHHHcTTccccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEETTTEEEEEEEcTTccEEEEEEEcTTcHHH DISOP:02AL 134-135| PSIPRED ccccEEEEEEcccHHHHHHHHHHcccEEccccccccEEEEEEcccEEEEEEcHHHHHHHHcccccccccccEEEEEEEEccHHHHHHHHHHHHHcccEEccccccccccEEEEEEcccccEEEEEEccHHHccc //