[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56402.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->90 3dwgC PDBj 1e-25 59.1 %
:RPS:PDB   3->90 3dwgC PDBj 1e-17 59.1 %
:RPS:SCOP  1->90 1wgkA  d.15.3.3 * 1e-18 25.6 %
:HMM:SCOP  1->90 1wgkA_ d.15.3.3 * 5e-27 50.0 %
:RPS:PFM   11->90 PF02597 * ThiS 3e-09 45.2 %
:HMM:PFM   5->90 PF02597 * ThiS 1.7e-24 43.6 78/78  
:BLT:SWISS 1->90 CF1A_MYCTU 2e-25 58.9 %
:PROS 1->86|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56402.1 GT:GENE AAZ56402.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2792037..2792315) GB:FROM 2792037 GB:TO 2792315 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56402.1 GB:DB_XREF GI:71916500 InterPro:IPR010916 LENGTH 92 SQ:AASEQ MAIEVRIPTILRNLTGGAKVVEGEGSTLAELITNLDKNHPGIGERLVENGQLRRFINVYLNDEDVRFLGGLDTPVNDGDTVTVLPAVAGGMR GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->90|CF1A_MYCTU|2e-25|58.9|90/93| PROS 1->86|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 3->90|3dwgC|1e-25|59.1|88/92| RP:PDB:NREP 1 RP:PDB:REP 3->90|3dwgC|1e-17|59.1|88/92| RP:PFM:NREP 1 RP:PFM:REP 11->90|PF02597|3e-09|45.2|73/79|ThiS| HM:PFM:NREP 1 HM:PFM:REP 5->90|PF02597|1.7e-24|43.6|78/78|ThiS| GO:PFM:NREP 1 GO:PFM GO:0006790|"GO:sulfur metabolic process"|PF02597|IPR003749| RP:SCP:NREP 1 RP:SCP:REP 1->90|1wgkA|1e-18|25.6|90/114|d.15.3.3| HM:SCP:REP 1->90|1wgkA_|5e-27|50.0|90/0|d.15.3.3|1/1|MoaD/ThiS| OP:NHOMO 106 OP:NHOMOORG 92 OP:PATTERN -----------------------1----------------------1--1-----------------1 2-112---------1--11-11--1111-11111111-222111---------11-----113-1112222-----------1-1111--------------------1-------------------------1-11111----111111112211-----111121111---------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------1-1----------------------------11111---------------------------------------------------------------1----------------------------------------------1-----------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 95.7 SQ:SECSTR ##EEEEccGGGGGGTTTccEEEEccccHHHHHHHHHHHcTTHHHHHccTTcccTTEEEEETTEEGGGTTGGGccccTTcEEEEEEccTTc## DISOP:02AL 91-92| PSIPRED cEEEEEEEEHHHHHccccEEEEcccccHHHHHHHHHHHcHHHHHHHHccccccccEEEEEcccccHHHcccccccccccEEEEEcccccccc //