[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56413.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:373 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   69->127 3eh2B PDBj 1e-04 21.1 %
:RPS:PFM   34->200 PF04213 * HtaA 3e-18 37.0 %
:HMM:PFM   34->199 PF04213 * HtaA 2.7e-53 44.5 164/168  
:HMM:PFM   346->371 PF10633 * NPCBM_assoc 0.00057 30.8 26/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56413.1 GT:GENE AAZ56413.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2802891..2804012) GB:FROM 2802891 GB:TO 2804012 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56413.1 GB:DB_XREF GI:71916511 LENGTH 373 SQ:AASEQ MNLGIRRAATVLVTAGLAAAASILPASATTTLPVTGGSGDWGVKLSFRNYIKSPIAHGSTELSGGVTENPDGTYSFPIVSGSYDTATGDTVIQFGGSVAYEGHGGVLRVRIDDLRLEITNGKGELYADMASSSPSDPQMVSYPDVNLADLDLSGGQPTLSGTTLSLGSTPATLTEEGSPAFAGFYSPGAELDPISFTATVGGSNGGGNQPPANGGSSAQQQILADVAAGPLILSVAGDTVQLTQSAPNGDGTYQTATGALNTATVSDLRGTNAGWNLVGQVSDFTGDVGTIGAENLGWTPSAAAVNTGVGTPGTVTAGSPVQPGQGLGIARTLASAAPGSSAGTFTADAQLTLGIPADTVPGDYAAVLTLTLS GT:EXON 1|1-373:0| SEG 8->32|aatvlvtaglaaaasilpasatttl| SEG 152->174|lsggqptlsgttlslgstpatlt| SEG 201->217|ggsngggnqppanggss| SEG 302->321|aaavntgvgtpgtvtagspv| RP:PDB:NREP 1 RP:PDB:REP 69->127|3eh2B|1e-04|21.1|57/739| RP:PFM:NREP 1 RP:PFM:REP 34->200|PF04213|3e-18|37.0|165/166|HtaA| HM:PFM:NREP 2 HM:PFM:REP 34->199|PF04213|2.7e-53|44.5|164/168|HtaA| HM:PFM:REP 346->371|PF10633|0.00057|30.8|26/78|NPCBM_assoc| OP:NHOMO 20 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----111-1111---------------------------------------------1--1--12--1232---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 15.3 SQ:SECSTR ####################################################################EccccEEEEEEEcccccTTTcEEEEE##EEEEEcTTccEEEEEEEEEEEEEccHHHHHT###################################################################################################################################################################################################################################################### DISOP:02AL 1-5, 202-224| PSIPRED ccHHHcccccccccccHHccccccccccccEEcccccEEEccHHEEEEEEEEccccccEEEEEEcEEEEcccEEEEEEccEEEEccccEEEEEEcccEEEEEEccEEEEEEEccEEEEEccEEEEEEEEEEccccccccccccEEEEEEEEcccccccccccEEEEccEEEEEccccHHHHccccccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEEccccEEEEEEcccccccccccccEEEccccEEEEcccccEEEEEEEEEEccccccccHHHccccEEEEEEEcccccccEEccccccccccccccccEEEEcccccccEEEEEEEEEEEcccccccccccEEEEEEEEc //