[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56420.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.7
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->91 1xbdA PDBj 3e-05 33.3 %
:HMM:SCOP  39->176 2mcmA_ b.1.7.1 * 3.1e-19 44.6 %
:BLT:SWISS 53->175 THIX_CORGL 3e-04 35.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56420.1 GT:GENE AAZ56420.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2810547..2811335 GB:FROM 2810547 GB:TO 2811335 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56420.1 GB:DB_XREF GI:71916518 LENGTH 262 SQ:AASEQ MFTIVRRFLSAAALVGLVAPLAVLTGSAAWAVPAAPSGGPSLTVSKTSGLNPDGEQVTVTGRGYDTSKGIYVSFCDISNANATTPPGPCIGGVDMSGESGSSVWISSNPPPYGQGLAQPYEGEGKNGSFTVQLTVKAKDEFTDCLAEGVQCAVVTRNDHTRSSDRSQDVFVPVTFAGQDDTGSGSGSGDGAGDGQTVGTTNNGGTPAAGGGGTSSGGKDGTLPTTGIDFAPFVLGALAVTGAGVAALLRARRLRLEGGNSSR GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 53->175|THIX_CORGL|3e-04|35.5|107/100| TM:NTM 1 TM:REGION 8->30| SEG 9->24|lsaaalvglvaplavl| SEG 96->107|sgesgssvwiss| SEG 176->221|agqddtgsgsgsgdgagdgqtvgttnnggtpaaggggtssggkdgt| SEG 233->255|vlgalavtgagvaallrarrlrl| BL:PDB:NREP 1 BL:PDB:REP 25->91|1xbdA|3e-05|33.3|63/87| HM:SCP:REP 39->176|2mcmA_|3.1e-19|44.6|101/0|b.1.7.1|1/1|Actinoxanthin-like| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-21---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 24.0 SQ:SECSTR ########################cccccccEEEcccTTccEEEEEccEEEcccccEEEEccccccEEEEEE####EcccccccccEEccc########################################################################################################################################################################### DISOP:02AL 180-194, 206-218, 254-262| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccEEEEEEcccccccccEEEEEEEEEcccccEEEEEEcccccccccccccccccEEEccccccEEEEccccccccccccccccccccccEEEEEEEEEEcccccHHHHcccEEEEEEEccccccccccEEEEEEEEEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHEEEccccccc //