[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56433.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56433.1 GT:GENE AAZ56433.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2822466..2822852) GB:FROM 2822466 GB:TO 2822852 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56433.1 GB:DB_XREF GI:71916531 LENGTH 128 SQ:AASEQ MSLTVSPELLDKARRGPVTDDEFIACIRESLPYAWDVITRLAEQIATDRLDYAANEVPPPGEKERGQLLRLLASDAMRGAVQRHFGLRLAFQNCHKVALFRPDAETAYQDFITPRAQLLNQSPELVDC GT:EXON 1|1-128:0| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----111----------------12-----1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHccccccccc //