[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56446.1
DDBJ      :             H+-transporting two-sector ATPase, A subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  676/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
f.18.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   113->278 1c17M PDBj 4e-08 29.3 %
:RPS:SCOP  107->278 1c17M  f.18.1.1 * 2e-23 25.9 %
:HMM:SCOP  105->279 1c17M_ f.18.1.1 * 1.3e-37 41.7 %
:RPS:PFM   74->278 PF00119 * ATP-synt_A 3e-28 43.4 %
:HMM:PFM   57->279 PF00119 * ATP-synt_A 1.7e-47 36.4 206/215  
:BLT:SWISS 30->285 ATP6_STRLI 3e-44 41.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56446.1 GT:GENE AAZ56446.1 GT:PRODUCT H+-transporting two-sector ATPase, A subunit GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2833992..2834849) GB:FROM 2833992 GB:TO 2834849 GB:DIRECTION - GB:PRODUCT H+-transporting two-sector ATPase, A subunit GB:PROTEIN_ID AAZ56446.1 GB:DB_XREF GI:71916544 InterPro:IPR000568 LENGTH 285 SQ:AASEQ MSADTLNLAAEGGGGLFTPGGPGFEAPSVGIFFPSPWSWGDYSEALPYTSGITKYAVLLVVATALVAFFLWWTTRKLAIVPSRKQSIFEIVVLFIRDQISRPMIGVKGDRYLPLLVSLFLFIFAMNIMGLIPFLQLPVTSNLSYPVGLAAVVYITFIAVGIRTHGFGRYFKSAVVPSGAPAWILPLLVPIEILSNFIIRPATHAIRLFATMFAGHLLLATFAAGGWYMFNPSAGPLYGTISVLFSGSALLAFIIFTAFELVIMFLQAFVFTLLAALYIGQAQEAH GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 30->285|ATP6_STRLI|3e-44|41.0|244/281| TM:NTM 6 TM:REGION 50->72| TM:REGION 113->135| TM:REGION 144->166| TM:REGION 176->198| TM:REGION 205->227| TM:REGION 247->269| SEG 12->24|gggglftpggpgf| SEG 56->70|avllvvatalvaffl| BL:PDB:NREP 1 BL:PDB:REP 113->278|1c17M|4e-08|29.3|133/142| RP:PFM:NREP 1 RP:PFM:REP 74->278|PF00119|3e-28|43.4|189/215|ATP-synt_A| HM:PFM:NREP 1 HM:PFM:REP 57->279|PF00119|1.7e-47|36.4|206/215|ATP-synt_A| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00119|IPR000568| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00119|IPR000568| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00119|IPR000568| RP:SCP:NREP 1 RP:SCP:REP 107->278|1c17M|2e-23|25.9|139/142|f.18.1.1| HM:SCP:REP 105->279|1c17M_|1.3e-37|41.7|156/171|f.18.1.1|1/1|F1F0 ATP synthase subunit A| OP:NHOMO 760 OP:NHOMOORG 716 OP:PATTERN --------------------------------------------------11---------------- 1111111111111111111-111111111111111111111111111111111111111111111121111111111111111111111111----1--11111111111--------------1221-1112112----------22----1-------1--11-1---111--1111---1-----111--1---------------111111----1--1-11111-1---11111111111111-----11-1--1--1111----1--11111111111111111111111111111111111111111----------1-1-----------1----11-------11-111111-1111-----111121111111112111211111111----------2-11111111-111111111111111111112112122111111111111--111111111111111111111111111111111111111111111111111111111121111111113111111111111111212111111111-1111111111211111-21121111---11111111221111112111-1-111111111111111111111111111-112-21----121---11-111111--111111-11111111111111111111-11111111111111111111111111111111111111111111-111111111111111111111-111111112221121211111111111111111111111111111111111111111111111111111111121111121211--1-1-----1111--1111----------------------------------------11-1------1-- ---------------------2-------1---111----------------------------11----1-----1----------2-----1---11------2------111-------1-2--1-12--1------1--11--------1--------11------1---1111------1--12-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 46.7 SQ:SECSTR ################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHTTccc##ccccHHHHHHHHHHHHHHH############HHHHHHHHHHHHHHHHHc#cccTTHHHHHHHHHHHHHHHHHHHHHHHHH##################HHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc####### DISOP:02AL 1-5, 283-285| PSIPRED ccHHHHHHHHHcccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //