[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56463.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   131->193 3c4rC PDBj 6e-08 11.1 %
:RPS:SCOP  3->193 1qgoA  c.92.1.2 * 2e-04 13.4 %
:HMM:SCOP  2->226 1qgoA_ c.92.1.2 * 9.8e-13 28.8 %
:HMM:PFM   11->99 PF01903 * CbiX 3.3e-06 28.1 89/105  
:HMM:PFM   131->215 PF01903 * CbiX 5.4e-08 31.8 85/105  
:BLT:SWISS 113->210 UTP10_EMENI 5e-04 33.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56463.1 GT:GENE AAZ56463.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2854708..2855397) GB:FROM 2854708 GB:TO 2855397 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56463.1 GB:DB_XREF GI:71916561 LENGTH 229 SQ:AASEQ MVPTMVLVADGTRDARRRDALHGLAEAVSDRREVPVCTAFGTRAELRDIVQSTAGPLVVVPAFLAGSDTASTELLAGLDLGGRFDACMTAPLGAVPSIVGQLIARLHAADWRPGDGIVLAVDGGLELSNDTEHRQVLDVARMLSRRLQTPVQIGYLREWAPSVTDAVARLRRNGHERVAVAAWQLVDGAELAELQDSGATTVTAPLGPSPVVVETLLAQHRAATARLAA GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 113->210|UTP10_EMENI|5e-04|33.7|95/100| SEG 13->20|rdarrrda| SEG 215->228|tllaqhraatarla| RP:PDB:NREP 1 RP:PDB:REP 131->193|3c4rC|6e-08|11.1|63/121| HM:PFM:NREP 2 HM:PFM:REP 11->99|PF01903|3.3e-06|28.1|89/105|CbiX| HM:PFM:REP 131->215|PF01903|5.4e-08|31.8|85/105|CbiX| RP:SCP:NREP 1 RP:SCP:REP 3->193|1qgoA|2e-04|13.4|187/257|c.92.1.2| HM:SCP:REP 2->226|1qgoA_|9.8e-13|28.8|219/0|c.92.1.2|1/1|Chelatase| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- --------------111----1---1------11111111-----1------1-----------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 27.5 SQ:SECSTR ##################################################################################################################################HHHHHHHHHHTTTcHHHHHHHHHHHHHTTcccccccTTcTTHHHHHHHHHHHHHHcccHHHHH#################################### DISOP:02AL 228-229| PSIPRED ccccEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccEEEEEEcHHcccccHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcc //