[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56476.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.3
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  29->84 1t1eA2  d.58.3.2 * 5e-04 14.3 %
:HMM:PFM   8->125 PF12158 * DUF3592 2.5e-17 30.5 118/148  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56476.1 GT:GENE AAZ56476.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2870725..2871120 GB:FROM 2870725 GB:TO 2871120 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56476.1 GB:DB_XREF GI:71916574 LENGTH 131 SQ:AASEQ MDRYYPLLPIGIGLCSLVWLVRDIVAAWLLGRRGERAEGTIVGYAETNSTSRMIVRFRTEEGEEVLALHDNSSWSAARYGDPVTVSYDPDNPQRARVVAAPWLSLWPRTLFLTVASGILLIGCFLGFLTWG GT:EXON 1|1-131:0| TM:NTM 2 TM:REGION 8->30| TM:REGION 108->129| SEG 117->128|gilligcflgfl| HM:PFM:NREP 1 HM:PFM:REP 8->125|PF12158|2.5e-17|30.5|118/148|DUF3592| RP:SCP:NREP 1 RP:SCP:REP 29->84|1t1eA2|5e-04|14.3|56/179|d.58.3.2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,34-34,39-39,73-73,76-76,101-101,104-104| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEEEcccccEEEEEEccccccHHcccccEEEEEccccccEEEEEEcccHHHcHHHHHHHHHHHHHHHHHHHHHHHcc //