[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56490.1
DDBJ      :             putative mutT-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->115 3ffuA PDBj 7e-09 38.5 %
:RPS:PDB   8->136 3ef5A PDBj 1e-10 24.6 %
:RPS:SCOP  8->130 1mutA  d.113.1.1 * 5e-11 20.8 %
:HMM:SCOP  1->133 1ryaA_ d.113.1.5 * 2.4e-27 38.6 %
:HMM:PFM   9->117 PF00293 * NUDIX 1.2e-24 38.9 108/135  
:BLT:SWISS 5->129 NUDG_ECOLI 3e-08 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56490.1 GT:GENE AAZ56490.1 GT:PRODUCT putative mutT-like protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2888253..2888696) GB:FROM 2888253 GB:TO 2888696 GB:DIRECTION - GB:PRODUCT putative mutT-like protein GB:PROTEIN_ID AAZ56490.1 GB:DB_XREF GI:71916588 InterPro:IPR000086 LENGTH 147 SQ:AASEQ MADGEVLIVVGAAIIRDDAVLAAQRAEPESMRGGWEFPGGKVDPGESEEEALIRECREELDVDVRPLERLPREVDFPTRPGSPRAVLRLWTAELLRGEPRLVEHLALRWLTPETLDDVDWLPTDAPFLDDVRNVLAPHSVSSSLLDK GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 5->129|NUDG_ECOLI|3e-08|30.6|121/135| SEG 46->60|eseeealirecreel| BL:PDB:NREP 1 BL:PDB:REP 4->115|3ffuA|7e-09|38.5|109/133| RP:PDB:NREP 1 RP:PDB:REP 8->136|3ef5A|1e-10|24.6|126/132| HM:PFM:NREP 1 HM:PFM:REP 9->117|PF00293|1.2e-24|38.9|108/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 8->130|1mutA|5e-11|20.8|120/129|d.113.1.1| HM:SCP:REP 1->133|1ryaA_|2.4e-27|38.6|132/160|d.113.1.5|1/1|Nudix| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----11--111--11------1--11-----11111--111111-1------1-1-----111----1--1--------1------------------------------------------------1-----------------------------------------------------------------------------------------1----1----------111111-1111111111--1--------------------------------------------------------------11---------------------------------1-1---------------------------------------------------------------------------------1-------------------------------------------------------------1-------------------------------------------------------------------------------1------------1-1-1----------------------------------------------------------------------------------1----------------------------------------11-1-1-1-111-111----------1-------------------------------------------------------------1---------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 93.9 SQ:SECSTR HTTcEEEEEEEEEcEETTEEEEEEccTTTcccccEEccEEEccTTccHHHHHHHHHHHHHccEEEcccEEEEEEEEEEEccccEEEEEEEEccEEEccccccccccEEEEcGGGGGGccccHHHHTTHHHHHHHTTcc######### DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEEEEccEEEEEEEcccccccccEEccccEEcccccHHHHHHHHHHHHcccEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEccccccccccEEEEccHHHHHccccccccHHHHHHHHHHHccccccHHHccc //