[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56494.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.145.1
:452 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->195 2vfuA PDBj 6e-06 26.2 %
:RPS:PDB   90->442 3bw7A PDBj 2e-19 13.0 %
:RPS:SCOP  90->184 1i19A2  d.145.1.1 * 4e-19 20.0 %
:HMM:SCOP  11->185 1w1oA2 d.145.1.1 * 4.2e-38 38.3 %
:RPS:PFM   395->450 PF04030 * ALO 2e-06 35.7 %
:HMM:PFM   19->154 PF01565 * FAD_binding_4 2.9e-29 35.6 135/138  
:HMM:PFM   384->449 PF04030 * ALO 9e-10 28.8 66/260  
:BLT:SWISS 90->240,322->452 YMP4_STRCO 2e-22 38.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56494.1 GT:GENE AAZ56494.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2892024..2893382 GB:FROM 2892024 GB:TO 2893382 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID AAZ56494.1 GB:DB_XREF GI:71916592 LENGTH 452 SQ:AASEQ MHRHRTPLTGWGLLRPTVATVVRPRTTDELAAVLRSAARGRGAVARGLGRSYGDAAQNADGTVVDCADLTPGFRVDAAAGTVTASAGTSLDTLLRHLLPRGFFLPVTPGTRQVTVGGAIAADVHGKNHHVDSSFGAHLRALTLVTPDGAVRRLGPDRDPDLFWATVGGMGLTGVITEATFTVLPVTTSRMRVDTDRIPDLEAALAAMTERDDDYRYSVCWLDLLARGRFLGRGVLTRAHHAHVADLPPAARRDPLRYRPRQGIRVPRGVPSRLLTPTTVRAFNTAYYAAAPRRRRDELQEVTAFFYPLDALRDWNRLYGSRGLVQYQFTVPFGQEETLRRIVEHLAKHQAPSFLAVLKRFGPGTPAPLSFPQPGWTLAVDLPADLPGLLPLLTRFDEWVLAAGGRLYLAKDSRAAAATVHAMYPELPRWHRVRDRVDPERVLVSDLARRLEL GT:EXON 1|1-452:0| BL:SWS:NREP 1 BL:SWS:REP 90->240,322->452|YMP4_STRCO|2e-22|38.9|280/367| SEG 15->27|rptvatvvrprtt| SEG 31->51|aavlrsaargrgavarglgrs| SEG 77->89|aaagtvtasagts| SEG 285->295|ayyaaaprrrr| SEG 377->392|lavdlpadlpgllpll| BL:PDB:NREP 1 BL:PDB:REP 52->195|2vfuA|6e-06|26.2|141/414| RP:PDB:NREP 1 RP:PDB:REP 90->442|3bw7A|2e-19|13.0|353/497| RP:PFM:NREP 1 RP:PFM:REP 395->450|PF04030|2e-06|35.7|56/259|ALO| HM:PFM:NREP 2 HM:PFM:REP 19->154|PF01565|2.9e-29|35.6|135/138|FAD_binding_4| HM:PFM:REP 384->449|PF04030|9e-10|28.8|66/260|ALO| GO:PFM:NREP 3 GO:PFM GO:0003885|"GO:D-arabinono-1,4-lactone oxidase activity"|PF04030|IPR007173| GO:PFM GO:0016020|"GO:membrane"|PF04030|IPR007173| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04030|IPR007173| RP:SCP:NREP 1 RP:SCP:REP 90->184|1i19A2|4e-19|20.0|95/217|d.145.1.1| HM:SCP:REP 11->185|1w1oA2|4.2e-38|38.3|175/206|d.145.1.1|1/1|FAD-binding domain| OP:NHOMO 112 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-11111111111111111111----1--------------------12-111-------------1--------------1-----1--------------------1-------1---------------11-------------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11--1----2---11-11111-11-------1--1------111-1-111-----1--1-----------------1--------------------------------------------------------11--------1-----1--1--1----------1------------------1-1--------------------------1--1--------------------1---2------1----------------------------1-----------------------------------------------------------------------------------------------------11111---------------------------------1-------------1------------------------111-------------1-111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 88.7 SQ:SECSTR ###################################################cccTTccTTcEEEEGGGGGccEEEcTTccEEEEETTccHHHHHHHHHTTTEEEccccccccccHHHHHTTccccTTHHHHccGGGcEEEEEEEETTccEEEEEccccHHHHHHHTTcTTccEEEEEEEEEEEEcEEEEEEEEEccHHHHHHHHHHHHcccccccccEEEEEEEEGGGHHHHHHTTccccHHHHHHHHHHTccEEEEEEEEEEEcccTTHHHHHHHHHHHHHHTccccTTcEEEEEEEHHHHHTHHHHHHHHHHHTTccccccccEEEEEEGGGHHHcccccTTTccccccEEEEEEEGGGccTTcccccccccEccccccTTcHHHHHHHHHHHHHHHHHTTcccEEcccccccHHHHHHHHcHHHHHHHHHHHHcTTcccGcccTTccHH DISOP:02AL 1-2| PSIPRED ccccccccccccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEHHHcccEEEEEccccEEEEEccccHHHHHHHHHHcccEEEcccccccccEEccccccccccccccccccEEEEEEEEEEcccccEEEEcccccHHHHHHHHHccccEEEEEEEEEEEEEcccEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEEccccccHHccHHHcccccEEccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEcHHHHccHHcccHHHcccccccEEEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHcc //