[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56498.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->143 2avnA PDBj 9e-06 34.1 %
:RPS:PDB   43->246 3bkwA PDBj 2e-12 17.9 %
:RPS:SCOP  32->146 2avnA1  c.66.1.41 * 3e-15 26.3 %
:HMM:SCOP  1->224 1p91A_ c.66.1.33 * 2.2e-25 25.6 %
:RPS:PFM   56->145 PF08241 * Methyltransf_11 1e-11 41.1 %
:HMM:PFM   56->144 PF08241 * Methyltransf_11 3.5e-20 37.1 89/95  
:HMM:PFM   18->78 PF00891 * Methyltransf_2 0.00076 24.6 61/241  
:BLT:SWISS 8->246 Y4481_MYCA9 2e-60 54.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56498.1 GT:GENE AAZ56498.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2897061..2897801 GB:FROM 2897061 GB:TO 2897801 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56498.1 GB:DB_XREF GI:71916596 InterPro:IPR000051 InterPro:IPR001601 LENGTH 246 SQ:AASEQ MTSPVPFRATVGRSVRLFAAFRKEQTDPDFFYGTLARDTVAQLQQYTELDGAIVADVGGGPGYFADALREAGARCLCVDADAGEMRLRDGVLPKNAVLGSALDLPLRTGSVDVCFSSNVLEHVPDPIRMADEMVRVTRPGGIIYLSYTLWLSPWGGHETSPWHYFGGHYAARRFTRRHGRRPKNDFGSTLFAVSAAEMIRWARRTPHASVVAILPRYLPWWAYPVVRIPVLREFLTWNLLLVLRRR GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 8->246|Y4481_MYCA9|2e-60|54.0|237/259| SEG 172->181|rrftrrhgrr| BL:PDB:NREP 1 BL:PDB:REP 54->143|2avnA|9e-06|34.1|88/242| RP:PDB:NREP 1 RP:PDB:REP 43->246|3bkwA|2e-12|17.9|201/215| RP:PFM:NREP 1 RP:PFM:REP 56->145|PF08241|1e-11|41.1|90/96|Methyltransf_11| HM:PFM:NREP 2 HM:PFM:REP 56->144|PF08241|3.5e-20|37.1|89/95|Methyltransf_11| HM:PFM:REP 18->78|PF00891|0.00076|24.6|61/241|Methyltransf_2| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 32->146|2avnA1|3e-15|26.3|114/246|c.66.1.41| HM:SCP:REP 1->224|1p91A_|2.2e-25|25.6|211/268|c.66.1.33|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 61 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -----1111111-111111-11112111111121111111-211-----11-----------2----1-21---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1----------11111111111--------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 100.0 SQ:SECSTR cccGccHHHTcccccHHHHHTcHHHHHHHHHHHTTTTTHHHHHHHccccTTcEEEEETcTTcHHHHHHHHTTccEEEEEEccHHHHHHHHTcccccEEccGGGccccTTcEEEEEEEccGGGcccHHHHHHHHHHHEEEEEEEEEEEEcHHHHccccccEEcTTccEEcccccTTccEEEcTTHHHHcccEEccHHHHHHHHHHHcTTTcEEEEEEEccccHHHHHHcGGGGGGGTccEEEEEEEc DISOP:02AL 1-5| PSIPRED cccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccEEEEEcccHHHHHHHHHcccccEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccHHHHHHHHHHHHHEEcc //