[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56504.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:300 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->108 PF05653 * DUF803 3.6e-07 23.8 101/300  
:HMM:PFM   224->282 PF05653 * DUF803 0.0004 27.1 59/300  
:HMM:PFM   188->233 PF07254 * DUF1434 0.00025 34.1 44/132  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56504.1 GT:GENE AAZ56504.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2908295..2909197 GB:FROM 2908295 GB:TO 2909197 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56504.1 GB:DB_XREF GI:71916602 LENGTH 300 SQ:AASEQ MTGLIAALVSAMVYGVGLTVEQRALHRSEPIGIRRPLHLARVLFGNPRWLAGCVLAALGSVGLIVSLGLAPVSVVQPTFAGGISLTLLLLSLAQQQRISRGELAALGIMPVALLLLALSLGPRDAAAGTVPHLPLLLTVSGVTLAVCAAGVALVGGGRASAALMGGAAGLAQGVAGLHGKGIGGLLADHGLFAALVPVLLSPFPYLYALGWAVGIALFQTSMQRSRASITAPAANVVGNVFTVVAGTVIFAEPLPTEPLPLVLRALGFLLTLTVVALVHRASGEAEAEAGRLRAAAQPTG GT:EXON 1|1-300:0| TM:NTM 9 TM:REGION 2->24| TM:REGION 48->70| TM:REGION 74->96| TM:REGION 100->122| TM:REGION 133->155| TM:REGION 161->183| TM:REGION 192->214| TM:REGION 229->251| TM:REGION 259->281| SEG 58->69|lgsvglivslgl| SEG 84->92|sltllllsl| SEG 112->120|allllalsl| SEG 141->179|gvtlavcaagvalvgggrasaalmggaaglaqgvaglhg| SEG 252->263|eplpteplplvl| SEG 280->296|rasgeaeaeagrlraaa| HM:PFM:NREP 3 HM:PFM:REP 2->108|PF05653|3.6e-07|23.8|101/300|DUF803| HM:PFM:REP 224->282|PF05653|0.0004|27.1|59/300|DUF803| HM:PFM:REP 188->233|PF07254|0.00025|34.1|44/132|DUF1434| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 285-288, 290-293, 296-300| PSIPRED cHHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccc //